[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65065.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:306 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->289 PF06626 * DUF1152 7e-41 43.5 %
:HMM:PFM   3->289 PF06626 * DUF1152 7.7e-114 54.8 283/297  
:BLT:SWISS 127->208 DAPB_RHOP2 4e-04 36.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65065.1 GT:GENE AAL65065.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2190775..2191695 GB:FROM 2190775 GB:TO 2191695 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL65065.1 GB:DB_XREF GI:18161810 LENGTH 306 SQ:AASEQ MPLYLAVGGGGDVVMAAALAGEEAVGQIPWERYVVDPEPGPVPPPSLREVLDLGNGLYLATPRSFAERGGRLFKTQGMCVAEALQKSVYLVDPYRRPSELAKALVRFDKIIGVDVGGDVLGVGCEESLRSPLADAYGLAVLAKASELGVEAELWVMSPGADGELSLEYLIRRVAEAAREGGLLGTVGLDSKQVEVLEKLVKRCVTEASAVAVRAFKGEYGPAHIRGGARLVEIGACALIGFKFSPKALLKLNKAARLIYESDAPIDKAADLLIENGIPTELHLEQLLAKGLDIYAALEELKKKKSC GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 127->208|DAPB_RHOP2|4e-04|36.6|82/100| SEG 6->21|avggggdvvmaaalag| SEG 34->45|vvdpepgpvppp| SEG 112->123|gvdvggdvlgvg| SEG 246->255|kallklnkaa| RP:PFM:NREP 1 RP:PFM:REP 25->289|PF06626|7e-41|43.5|262/297|DUF1152| HM:PFM:NREP 1 HM:PFM:REP 3->289|PF06626|7.7e-114|54.8|283/297|DUF1152| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN 11-1111111111111--111111-----------------------------1-------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 304-306| PSIPRED ccEEEEEcccHHHHEEEEEcccEEEEEEEEcEEEEccccccccHHHHHHHHHHHHHHHHHccHHHHHcccEEEHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHEEEccccEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEEcccccccEEcccHHHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccc //