[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65067.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.3
:280 amino acids
:PSIPRED
:DISOPRED
:RPS:PDB   5->28 3a43B PDBj 9e-04 36.4 %
:RPS:SCOP  4->37 1pftA  g.41.3.1 * 2e-06 47.1 %
:RPS:PFM   3->32 PF05876 * Terminase_GpA 6e-04 50.0 %
:HMM:PFM   4->38 PF08271 * TF_Zn_Ribbon 1e-10 31.4 35/43  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65067.1 GT:GENE AAL65067.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2192513..2193355) GB:FROM 2192513 GB:TO 2193355 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL65067.1 GB:DB_XREF GI:18161812 LENGTH 280 SQ:AASEQ MIIQCPFCGAKYEAPPGRGFYVCPYCGTVISEGRTFENVYIFKPSVDKTTAFKKALNFRPFGSPEDLPQASPSGADLHFLPLYLYHITFQPLEELETYASALAMSNPPVKLPRNYVFPARWRAPFKPSLERIGVFHSPDLSPEEAFRSLNDVLEEAHAYASVFKTKVTVRWSFEGIVYYPLWNLSYLYRGRNYKAVVDAAEGSVFYMEYPISRRGRAGGLGLAAGSLLATAAVGALTAHYLGLYPQIGALGGALAGLGAAVRLLAFAASRTGRYEAQYKL GT:EXON 1|1-280:0| SEG 217->238|agglglaagsllataavgalta| SEG 248->268|galggalaglgaavrllafaa| RP:PDB:NREP 1 RP:PDB:REP 5->28|3a43B|9e-04|36.4|22/117| RP:PFM:NREP 1 RP:PFM:REP 3->32|PF05876|6e-04|50.0|30/552|Terminase_GpA| HM:PFM:NREP 1 HM:PFM:REP 4->38|PF08271|1e-10|31.4|35/43|TF_Zn_Ribbon| RP:SCP:NREP 1 RP:SCP:REP 4->37|1pftA|2e-06|47.1|34/50|g.41.3.1| OP:NHOMO 9 OP:NHOMOORG 8 OP:PATTERN ------------------11111----------------------------------112-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 275-276| PSIPRED cEEEccccccEEEccccEEEEEEcccccEEEcccEEEEEEEEEccccccHHHHHHHcccccccccccccccEEEEcEEEEEEEEEEEEEEEEEEEEEEEEHHccccccEEEEEccEEEEEEcccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccEEEEcEEEEEEEEcccEEEEEEEccccEEEEEEccHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcc //