[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65071.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:KPTA_PYRAE   RecName: Full=Probable RNA 2'-phosphotransferase;         EC=2.7.1.-;

Homologs  Archaea  26/68 : Bacteria  82/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
d.166.1
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->206 1wfxA PDBj 2e-28 44.7 %
:RPS:SCOP  34->206 1wfxA  d.166.1.5 * 5e-59 42.8 %
:HMM:SCOP  34->211 1wfxA_ d.166.1.5 * 7.7e-54 42.7 %
:RPS:PFM   34->196 PF01885 * PTS_2-RNA 4e-18 38.0 %
:HMM:PFM   33->196 PF01885 * PTS_2-RNA 3.9e-48 37.2 164/186  
:HMM:PFM   1->13 PF06397 * Desulfoferrod_N 6.4e-05 53.8 13/36  
:BLT:SWISS 1->213 KPTA_PYRAE e-123 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65071.1 GT:GENE AAL65071.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2196349..2196990 GB:FROM 2196349 GB:TO 2196990 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL65071.1 GB:DB_XREF GI:18161816 LENGTH 213 SQ:AASEQ MNDVYKCPVCGQLTESPTHCGVSAVKILDGAMRLKISKLLSLALRHSPSVLGLSLDKGGWADVKTALEGLRKAGIRADYEALYAVVALDEKGRFELKDGKIRARYGHTIDVEVEYEADSESKVLYHGTSRHLLPSIMAQGLLPMRRRYVHLSPDFATACQNARRRPLPVVIEIDAECLRARGYVVYAASGKVRLAKHVPPECLKKVVDCPTPS GT:EXON 1|1-213:0| SW:ID KPTA_PYRAE SW:DE RecName: Full=Probable RNA 2'-phosphotransferase; EC=2.7.1.-; SW:GN Name=kptA; OrderedLocusNames=PAE3647; SW:KW Complete proteome; NAD; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->213|KPTA_PYRAE|e-123|100.0|213/213| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 34->206|1wfxA|2e-28|44.7|170/177| RP:PFM:NREP 1 RP:PFM:REP 34->196|PF01885|4e-18|38.0|163/186|PTS_2-RNA| HM:PFM:NREP 2 HM:PFM:REP 33->196|PF01885|3.9e-48|37.2|164/186|PTS_2-RNA| HM:PFM:REP 1->13|PF06397|6.4e-05|53.8|13/36|Desulfoferrod_N| GO:PFM:NREP 2 GO:PFM GO:0006388|"GO:tRNA splicing, via endonucleolytic cleavage and ligation"|PF01885|IPR002745| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF01885|IPR002745| RP:SCP:NREP 1 RP:SCP:REP 34->206|1wfxA|5e-59|42.8|173/180|d.166.1.5| HM:SCP:REP 34->211|1wfxA_|7.7e-54|42.7|178/0|d.166.1.5|1/1|ADP-ribosylation| OP:NHOMO 145 OP:NHOMOORG 135 OP:PATTERN 11-111------------1111121-----------------------111111111111--11---- ----1-------------------------------------------------------1---1--111-----------2-------------------1---11------------------------------11-1---1-1--------------------1-1-------------1-------------------------------1---------------11------------------------11---------11-------------------------------------------1-------------1---------------111--1---1------------------11--1----------------------------------------------111-11-111-------------------------------------------------------------------------1--------------1-----1----------------1------------1-------------------------------------------1-------------------------------------------------------------------------------1---1-1111----111-1-1-1111111----11--------------------11-111------------------------------1-----------------------------111--1--------11------------------------------------------1------------------------------------------------------- ------------11------------------------------------1-11--1-----111----1----11-----111-11-----------------------2----1-------------------------------------1---11-----------1--------7------1---11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 79.8 SQ:SECSTR #################################ccHHHHHHHHHHTcTGGGTccccTTccEEHHHHHHHHHHTTcTTccHHHHHHHHHcccccEEEETTEEEEcccccccccccccccccccEEEEcccGGGHH#HHHHcccc#ccccEEEEccHHHHHHHHTTccccEEEEEEHHHHHHTTccc#EEcccEEEEccccGGGEEEE####### DISOP:02AL 1-2, 14-32, 211-213| PSIPRED cccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHccHHHcccEEcccccccHHHHHHHHHHccccccHHHHHHHHHHccccEEEEcccEEEEEEccEEEEEEcccccccccEEEEcccHHHHHHHHHHcccccccEEEEEcccccccEEEEEEcccEEEEEEcHHHHHHcccEEEEEcccEEEEccccHHHHHHHHcccccc //