[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65072.1
DDBJ      :             conserved protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   209->273 1bibA PDBj 2e-09 17.2 %
:RPS:SCOP  209->263 1ft9A1  a.4.5.4 * 5e-08 16.4 %
:HMM:SCOP  186->273 1ku9A_ a.4.5.36 * 9.5e-11 27.3 %
:RPS:PFM   215->257 PF09339 * HTH_IclR 8e-04 41.9 %
:HMM:PFM   223->258 PF09339 * HTH_IclR 3.1e-08 36.1 36/52  
:BLT:SWISS 9->106 DIG1_CAEEL 2e-05 34.4 %
:BLT:SWISS 210->272 Y614_PYRHO 5e-06 31.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65072.1 GT:GENE AAL65072.1 GT:PRODUCT conserved protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2197261..2198082 GB:FROM 2197261 GB:TO 2198082 GB:DIRECTION + GB:PRODUCT conserved protein GB:NOTE Transport and binding proteins; Unknown substrate GB:PROTEIN_ID AAL65072.1 GB:DB_XREF GI:18161818 LENGTH 273 SQ:AASEQ MLILLLPAAIVGNYSLPAPPASDVAALTPSGTPLPTWVINGTLYVLQGGDSAIAMYVPRFENASGVYTITLRGGRVVVQAPPGVMIEDISPRPERVVVNKTGLYLYLTGDVKVTYYFFTVTVTPPRPPPSPTTPPPTSPPTTATPTPSPSPPPTATPTQPQSPTVATPSASPQQGQALGTELLIAAALVAAITAVLLLRKRGRGNCADLNETDQAIIKALIDRGGVADRSDLQEALGLPKTTLHRHLHKLAKYGYIKLEQLGGRQRVELLRKC GT:EXON 1|1-273:0| BL:SWS:NREP 2 BL:SWS:REP 9->106|DIG1_CAEEL|2e-05|34.4|96/13100| BL:SWS:REP 210->272|Y614_PYRHO|5e-06|31.7|63/332| TM:NTM 2 TM:REGION 1->23| TM:REGION 177->198| SEG 111->169|vkvtyyfftvtvtpprpppspttppptsppttatptpspsppptatptqpqsptvatps| SEG 182->198|lliaaalvaaitavlll| RP:PDB:NREP 1 RP:PDB:REP 209->273|1bibA|2e-09|17.2|64/294| RP:PFM:NREP 1 RP:PFM:REP 215->257|PF09339|8e-04|41.9|43/52|HTH_IclR| HM:PFM:NREP 1 HM:PFM:REP 223->258|PF09339|3.1e-08|36.1|36/52|HTH_IclR| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF09339|IPR005471| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF09339|IPR005471| RP:SCP:NREP 1 RP:SCP:REP 209->263|1ft9A1|5e-08|16.4|55/78|a.4.5.4| HM:SCP:REP 186->273|1ku9A_|9.5e-11|27.3|88/151|a.4.5.36|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 8 OP:NHOMOORG 6 OP:PATTERN -----1------------12211--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 24.5 SQ:SECSTR ##############################################################################################################################################################################################################cTccHHHHHHHHHHTTccccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEccccccc DISOP:02AL 124-177| PSIPRED cEEEEEEccccccccccccccccEEEEEcccccccEEEcccEEEEEccccccEEEEEEEEccccccEEEcccccEEEEEcccccccccccccccEEEccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEccccHHHHHcccHHHHHHHHHHHHHccEEEHHHHHHHHcccHHHHHHHHHHHHHccEEEEEEEccEEEEEEEEcc //