[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65074.1
DDBJ      :             5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  493/915 : Eukaryota  108/199 : Viruses  0/175   --->[See Alignment]
c.1.22
:389 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->386 1t7lA PDBj 1e-25 28.8 %
:RPS:PDB   10->385 3bq6B PDBj 2e-34 26.1 %
:RPS:SCOP  6->385 1u1hA2  c.1.22.2 * 1e-43 23.7 %
:HMM:SCOP  13->387 1u1jA1 c.1.22.2 * 2.2e-68 34.3 %
:RPS:PFM   15->378 PF01717 * Meth_synt_2 2e-39 35.4 %
:HMM:PFM   12->222 PF01717 * Meth_synt_2 1.3e-31 26.3 198/324  
:HMM:PFM   273->380 PF01717 * Meth_synt_2 7.9e-18 31.7 101/324  
:BLT:SWISS 14->385 METE_SULTO 8e-44 39.0 %
:PROS 237->246|PS00659|GLYCOSYL_HYDROL_F5

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65074.1 GT:GENE AAL65074.1 GT:PRODUCT 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2199434..2200603) GB:FROM 2199434 GB:TO 2200603 GB:DIRECTION - GB:PRODUCT 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase GB:NOTE Amino acid biosynthesis; Aspartate family GB:PROTEIN_ID AAL65074.1 GB:DB_XREF GI:18161820 LENGTH 389 SQ:AASEQ MSEFLMTLPRAFITSVVGSWPRPTWLIEAFEKYEKGELDRQTFSQYLDDAVKLAIKDQEEAGLDVITDGEQRRTSFVAFVGQKLKGFKIVRVEELHPSAKEIMKKYKAPLTLWRPVIAGYIEDSVLAVDEVQYAKKVTQKPLKVTLPSPYLIMWEAWHAKISAPYYPRPEDAAEAYVKVLRNEISRLINAGVAFIQLDEPMLGDLIEAEPDKPDRYKQVASELYGQKYRGLRDEIQLAVDLVNEVVQGFGTSVRIGMHLDRWPTEDSPIVGYERLAPQIFDVKVKQYVVEYKHPRMGNPEEFAKILPSDKEIGLGSIDVRDPKRVETPEEVVAHVERIVKYVDPVRIWLNPDCGFAPGMYRAFPRQAALEKLKAMVKAAKILREKYWWA GT:EXON 1|1-389:0| BL:SWS:NREP 1 BL:SWS:REP 14->385|METE_SULTO|8e-44|39.0|305/338| PROS 237->246|PS00659|GLYCOSYL_HYDROL_F5|PDOC00565| BL:PDB:NREP 1 BL:PDB:REP 12->386|1t7lA|1e-25|28.8|326/734| RP:PDB:NREP 1 RP:PDB:REP 10->385|3bq6B|2e-34|26.1|330/718| RP:PFM:NREP 1 RP:PFM:REP 15->378|PF01717|2e-39|35.4|316/323|Meth_synt_2| HM:PFM:NREP 2 HM:PFM:REP 12->222|PF01717|1.3e-31|26.3|198/324|Meth_synt_2| HM:PFM:REP 273->380|PF01717|7.9e-18|31.7|101/324|Meth_synt_2| GO:PFM:NREP 2 GO:PFM GO:0003871|"GO:5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity"|PF01717|IPR002629| GO:PFM GO:0009086|"GO:methionine biosynthetic process"|PF01717|IPR002629| RP:SCP:NREP 1 RP:SCP:REP 6->385|1u1hA2|1e-43|23.7|321/352|c.1.22.2| HM:SCP:REP 13->387|1u1jA1|2.2e-68|34.3|321/0|c.1.22.2|1/1|UROD/MetE-like| OP:NHOMO 772 OP:NHOMOORG 631 OP:PATTERN 11-2-11111111111-211111-1--11111----------------------111-1--------- 1-2--1-111111111111-1-1111111111----12231---1-1-1---111111-------13112-11111111---211111------------12---11221----------1111-----------1---11----211-----21----------1----1-----------------21-1-1111111111111111212212111---11--21122211-1111111111111121122------1-11-1122-----231121111----21111111111111-------------1--111----1---1------------11--------2-21-1-----1-------1--2-1--11--------33311212113--------------------211--11----------------1-------1111111111111--1--------------------------------1-1211111111112111111111111112111112--111--1111-2-2112-1111111111111111----------1--1111--------1---------11111-------1--------2-11111111111-1111222211-111211112111---1-1-11---32331331111111111-1111111111111-11111333331111111111111111111311111111-111111111111-1--11111----11111222-1---1111221111111111111111122111111111-1---------1-1111111122222111111111111111--------------------------------------------------1-1111-- ----12--211-23111111111131111111111112-12-111122211222-1223222111111111111111-1111111111-261123311113-1122-1-12----------------------------------------------------------------1-------11--2221-1-2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 381 STR:RPRED 97.9 SQ:SECSTR #####HcccccccccccccccccHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHTccccccccTTcccTTHHHHTTcEEEEccccccEEEETTEEEcccEEEEEEEcccccHHHHHccccHHHHHHHHTTccccccEEEEcHHHHHHTcEEcccccHccccHHHHHHHHHHHHHHHHHHHHHTTccEEEEEcTHHHHTccccGGGHHcHHHHHHHTccccGGGHHHHHHHHHHHHHHHTccccTTcEEEEEccccccGGccccccTTTHHHHTTccccEEEEccTTTTTGGGHHHHTcTTcccEEEEEcccTTcccccccHHHHHHHHHHHTTTccGGGEEEEcccccTTcccHTccHHHHHHHHHHHHHHHHHHHHcT### DISOP:02AL 1-6| PSIPRED cccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHcccEEEEEccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEcccccccHHHHHHHcccccEEEEEEEEcccccccccHHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc //