[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65081.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:703 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  444->536 1eutA1  b.1.18.2 * 9e-05 23.3 %
:RPS:SCOP  560->648 1eutA1  b.1.18.2 * 5e-04 15.7 %
:HMM:PFM   561->631 PF10633 * NPCBM_assoc 2.1e-06 34.3 70/78  
:HMM:PFM   306->379 PF00801 * PKD 1.3e-05 27.4 62/69  
:HMM:PFM   683->700 PF08693 * SKG6 0.0005 55.6 18/40  
:BLT:SWISS 288->533 YKL1_SCHPO 3e-07 27.1 %
:BLT:SWISS 564->634 Y795_METJA 9e-04 28.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65081.1 GT:GENE AAL65081.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2205818..2207929 GB:FROM 2205818 GB:TO 2207929 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL65081.1 GB:DB_XREF GI:18161827 LENGTH 703 SQ:AASEQ MKWTITALVISMALAALAYSQATVGLTPSVDYLWLGAKWSQVPKYPGDIGVLTLSYYLSNQYVDVSVYIDPKCPYLTPLETARLPSAGPGVVTVALKVSVSALNVTCPVNVVFHATYKAAGSSLTDGMEKVEYAEIYIPPYPTAEVSARGVAYIGLPSAITLIVKSPYLLMASLSVQGQGARVLSPTGQYAVNSTYAEIPVILIADTYSASLLVTIQARDWLGNPVALTYAVPVAAAPTPPPVLYISPTTLYLNKYNRVNLTIQLPVAADGLAVVTASGAVMPQSSITIPIKNGRGSGQVEVYPVANAVVFTAQVTYQTSGVSKTDQISATVSVQQTVGGIAKVVVKPSRLIAGVTNNVTLIASAPGPFNVSVTVSNAAVDKPQPFYFGGADTASASLLITPLSNQPVTIAVSIYHSAGVDQYTINLPVTSSSIYTVIPTPSIVKSGGNRTVIVTVINSGDVAVQKAVVTISPASGNVLASTYTFQISRLAPLDSVQLPISFIVPATYSGTIAFTYNIVYTTELGTTSSAQGTFYLQSLQTPVVNITSVTVVPTVPEPRRTFYISLTVVNKGFASVSNLQVEAKLPRGIRPVTSPIYFAGQLDSQQTATIPLSFNATAPGQYQIELTISYTDQYGNYYTIPYTVTINVANGTRFLGPGGRPTTAPQVGASNFGQTWTYAAAAVAVIIAVISALYLTRRRKLKS GT:EXON 1|1-703:0| BL:SWS:NREP 2 BL:SWS:REP 288->533|YKL1_SCHPO|3e-07|27.1|240/1220| BL:SWS:REP 564->634|Y795_METJA|9e-04|28.2|71/504| TM:NTM 2 TM:REGION 1->20| TM:REGION 675->696| SEG 225->245|pvaltyavpvaaaptpppvly| SEG 541->558|tpvvnitsvtvvptvpep| SEG 679->690|aaaavaviiavi| HM:PFM:NREP 3 HM:PFM:REP 561->631|PF10633|2.1e-06|34.3|70/78|NPCBM_assoc| HM:PFM:REP 306->379|PF00801|1.3e-05|27.4|62/69|PKD| HM:PFM:REP 683->700|PF08693|0.0005|55.6|18/40|SKG6| RP:SCP:NREP 2 RP:SCP:REP 444->536|1eutA1|9e-05|23.3|86/103|b.1.18.2| RP:SCP:REP 560->648|1eutA1|5e-04|15.7|85/103|b.1.18.2| OP:NHOMO 12 OP:NHOMOORG 8 OP:PATTERN ------------1---1122122--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 701-703| PSIPRED cEEEEHHHHHHHHHHHHHHccEEEccccccEEEEEccEEcccccccccEEEEEEEEEEEccEEEEEEEEcccccccccccccccccccccEEEEEEEEEEEEEEEEccEEEEEEEEEHHccccHHHHHcEEEEEEEEEcccccccccccEEEEEEccEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccccEEEEEEEEcEEEEEccccEEEEEEEEEccccccEEEEEEEccEEEEcccccEEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEcccccccccccccccccccEEEEEEEEccccEEEEEEEEEEEccEEEEEEEEEEEEEcHHccccccEEEEccEEcccccccEEEEEEccEEEEEEEEEccccccccccEEEcccHHcccEEEEcccccccEEEEEEEEEcccccEEEEEEEEEEccEEEEEEcccEEEccccEEEEEEEEEcccccccEEEEEEccccccccccccEEEcccccccccccEEEEEEEEcccEEEEEEEEEEEEEEccccccccccEEEEEEEccccEEEEccEEcccEEEcccEEEEEEEEEEcccEEEEEEEEEEEcccccEEccccEEEEEEEcccccEEEEEEEEccccccEEEEEEEEEEcccccEEEEEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //