Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20831.1
DDBJ      :             possible ubiquitin binding protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:HMM:PFM   4->59 PF09838 * DUF2065 3.8e-24 41.1 56/57  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20831.1 GT:GENE AAZ20831.1 GT:PRODUCT possible ubiquitin binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(6249..6434) GB:FROM 6249 GB:TO 6434 GB:DIRECTION - GB:PRODUCT possible ubiquitin binding protein GB:PROTEIN_ID AAZ20831.1 GB:DB_XREF GI:71061828 LENGTH 61 SQ:AASEQ MKELIIAFGLFLFIEGILYALFPSKMKSMLKKMEMIKDSQLRSGGLIFAVIGFIIIWYIKS GT:EXON 1|1-61:0| TM:NTM 2 TM:REGION 4->25| TM:REGION 39->61| SEG 25->37|kmksmlkkmemik| HM:PFM:NREP 1 HM:PFM:REP 4->59|PF09838|3.8e-24|41.1|56/57|DUF2065| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 61-62| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHc //