[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20836.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  1/199 : Viruses  2/175   --->[See Alignment]
a.204.1
:123 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   49->117 2rfpA PDBj 5e-06 38.8 %
:RPS:PDB   47->86 2a3qA PDBj 1e-04 17.5 %
:RPS:SCOP  47->84 1y6xA1  a.204.1.4 * 2e-05 23.7 %
:HMM:SCOP  37->88 1vmgA_ a.204.1.2 * 0.00025 34.6 %
:HMM:PFM   7->89 PF01503 * PRA-PH 2.3e-30 44.6 83/83  
:BLT:SWISS 2->79 YL479_MIMIV 1e-08 39.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20836.1 GT:GENE AAZ20836.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(10519..10890) GB:FROM 10519 GB:TO 10890 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE possibly viral GB:PROTEIN_ID AAZ20836.1 GB:DB_XREF GI:71061833 LENGTH 123 SQ:AASEQ MSNFNKVKTFMETFGQEVKTKPSFSTDKINSLRYDLIKEELEELKEAMENKDLLEVADALTDILYVTYGAGHAFGIDLDKCFAEVQNSNMSKLGEDGKPIYNESGKVMKGPKYFKPDLTKFVN GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 2->79|YL479_MIMIV|1e-08|39.7|78/100| SEG 38->46|keeleelke| BL:PDB:NREP 1 BL:PDB:REP 49->117|2rfpA|5e-06|38.8|67/165| RP:PDB:NREP 1 RP:PDB:REP 47->86|2a3qA|1e-04|17.5|40/112| HM:PFM:NREP 1 HM:PFM:REP 7->89|PF01503|2.3e-30|44.6|83/83|PRA-PH| RP:SCP:NREP 1 RP:SCP:REP 47->84|1y6xA1|2e-05|23.7|38/87|a.204.1.4| HM:SCP:REP 37->88|1vmgA_|0.00025|34.6|52/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------------------------11--------------------------------1111---------------------------------------1----------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1------- STR:NPRED 70 STR:RPRED 56.9 SQ:SECSTR ##############################################GccHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHH#HTccTTccccccTTTcccccTTccccH###### PSIPRED cccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHccccEEEEcccccccccccccccHHHHHcc //