[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20868.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:46 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->42 PF08977 * BOFC_N 0.00014 30.8 39/59  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20868.1 GT:GENE AAZ20868.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(52886..53026) GB:FROM 52886 GB:TO 53026 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20868.1 GB:DB_XREF GI:71061865 LENGTH 46 SQ:AASEQ MVFFLRKLAVGSLVSSFFILMQAQAGIVEVVNKQFKDLSIKLSTTF GT:EXON 1|1-46:0| TM:NTM 1 TM:REGION 8->30| HM:PFM:NREP 1 HM:PFM:REP 3->42|PF08977|0.00014|30.8|39/59|BOFC_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-47| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcEEEEEEccc //