[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20870.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20870.1 GT:GENE AAZ20870.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 55348..55692 GB:FROM 55348 GB:TO 55692 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20870.1 GB:DB_XREF GI:71061867 LENGTH 114 SQ:AASEQ MSKIKIVFYLALAFIFYKGFVAFQNFEIGVDDRVASIEEKADFEKEGEVIGLMMYLGDPPELYEHLLTKNKSRCLEMRQTAEESSSAYYECARVNAVLKGGKIVSIINEIEVIE GT:EXON 1|1-114:0| TM:NTM 1 TM:REGION 5->23| SEG 103->113|ivsiineievi| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 77-84| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccEEEEEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHEEHHHHHHccc //