[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20877.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20877.1 GT:GENE AAZ20877.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(65036..65326) GB:FROM 65036 GB:TO 65326 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20877.1 GB:DB_XREF GI:71061874 LENGTH 96 SQ:AASEQ MKKIILIFLLIPLLNNCGPYSAALGPSLTLVNSGSILQASASYAGSSTMKKFKKDYINELNVEKICPTVHSSELNEIFFETIDHMDCYFDPMSIHR GT:EXON 1|1-96:0| SEG 4->14|iilifllipll| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31,34-34,39-40,45-46,48-48,53-53,59-59,62-62,67-67,81-81,87-87| PSIPRED ccEEHHHHHHHHHHccccccHHHccccEEEEEcccEEEEccccccHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHcccHHHccc //