[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20894.1
DDBJ      :             type IV pilus assembly protein PilW
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:234 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   180->203 PF02770 * Acyl-CoA_dh_M 0.00046 41.7 24/52  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20894.1 GT:GENE AAZ20894.1 GT:PRODUCT type IV pilus assembly protein PilW GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(85664..86368) GB:FROM 85664 GB:TO 86368 GB:DIRECTION - GB:PRODUCT type IV pilus assembly protein PilW GB:PROTEIN_ID AAZ20894.1 GB:DB_XREF GI:71061891 LENGTH 234 SQ:AASEQ MGGALIVISSGDHQSNNTSDQYQQTFYVAEHALIEAEKRIINRMIGPWTEVSTITTPPVGSTPTEITAHNNYIEQLTATAIDGFARNTDGRDTPRNTLTPVETPCFKSFRNLIRNDSGGNLSLVTDHFTNQNFGSLIEPILNTPSDVGLEADDAEKEKEYLKRYRYEFFSINVGSSTFKGAGASLKKTSTNAQRQGTAYRIYGCGYLMPKGAELGEFEDPEILIPLETLIILSS GT:EXON 1|1-234:0| SEG 220->232|peilipletliil| HM:PFM:NREP 1 HM:PFM:REP 180->203|PF02770|0.00046|41.7|24/52|Acyl-CoA_dh_M| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 13-19, 186-192| PSIPRED cccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccEEEEccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHEEEEEEcccccccccccccHHccccHHHcccEEEEEEccEEcccccccccccccEEEEEEEHEEEEcc //