[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20896.1
DDBJ      :             Putative pilV-like pilin protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->27 PF07963 * N_methyl 2.2e-05 42.1 19/20  
:HMM:PFM   123->182 PF05483 * SCP-1 3.9e-05 41.8 55/786  
:PROS 9->29|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20896.1 GT:GENE AAZ20896.1 GT:PRODUCT Putative pilV-like pilin protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(87366..88016) GB:FROM 87366 GB:TO 88016 GB:DIRECTION - GB:PRODUCT Putative pilV-like pilin protein GB:NOTE similar to PilV GB:PROTEIN_ID AAZ20896.1 GB:DB_XREF GI:71061893 LENGTH 216 SQ:AASEQ MKKQKHNISGLSLIEALVSVVIIGIGFVSILQMTNFSVQSIDNSGDRTKANFLTEMIVEDVIGSKNSFYGVNSDNENIIYSTDGTASLDGDTLNTFSKHLSDNSWSADLSCGGSSSNTTTPVENKQNIYETQQVDAPRNKQAKWNTIFEENRFLKCKSTTEEKKLQVFEICKWDACDYKLDSITDEPLYIGRVEMKLNEGKKRKFIYFQSDYKLKQ GT:EXON 1|1-216:0| PROS 9->29|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 11->33| SEG 18->30|vsvviigigfvsi| HM:PFM:NREP 2 HM:PFM:REP 9->27|PF07963|2.2e-05|42.1|19/20|N_methyl| HM:PFM:REP 123->182|PF05483|3.9e-05|41.8|55/786|SCP-1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHHHcccccEEEccccccEEEEEccccccccccHHHHHHHHHcccccccEEEcccccccccccccccHHHHHHHHccccccccccccEEEccccEEEEcccccHHHHHHHHHHccccccccccccccccEEEEEEEEEEcccccEEEEEEEcccEEcc //