[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20936.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->111 PF05258 * DUF721 1.4e-14 26.7 86/89  
:HMM:PFM   83->143 PF01643 * Acyl-ACP_TE 0.00069 23.3 60/249  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20936.1 GT:GENE AAZ20936.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 123415..123903 GB:FROM 123415 GB:TO 123903 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20936.1 GB:DB_XREF GI:71061933 LENGTH 162 SQ:AASEQ MQFKNNTKQRFKTIQGLRSFKDTLPKNIKKIIKKKGHIFSETLNNWKYIVGDDLFQICYPKSFKNSNKFGVSTLQIMVKRGHEIDLEYSKKIIMDKMNSFFGYAVVEKLKFISFDDAQTKFKKLDTNENHVTNIKYADRINSIKNDKIKKSLLELTKLFKQR GT:EXON 1|1-162:0| SEG 26->35|knikkiikkk| SEG 140->151|insikndkikks| HM:PFM:NREP 2 HM:PFM:REP 20->111|PF05258|1.4e-14|26.7|86/89|DUF721| HM:PFM:REP 83->143|PF01643|0.00069|23.3|60/249|Acyl-ACP_TE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 116-143, 161-162| PSIPRED cccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcHHHHHccEEEEccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc //