[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20939.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->84 PF09527 * ATPase_gene1 8e-05 34.0 %
:HMM:PFM   45->86 PF09527 * ATPase_gene1 2.7e-07 23.8 42/61  
:BLT:SWISS 36->84 Y024_RICPR 2e-07 41.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20939.1 GT:GENE AAZ20939.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 127081..127356 GB:FROM 127081 GB:TO 127356 GB:DIRECTION + GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ20939.1 GB:DB_XREF GI:71061936 LENGTH 91 SQ:AASEQ MPKDSLKTRLEIAKNKLSKKNLYKNEEAPSSIGTAFKLSTELVSAVAVGTIIGFILDKTFGTKPWLILIFFFVGVVAGIINVFRSAKNMQK GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 36->84|Y024_RICPR|2e-07|41.7|48/82| TM:NTM 2 TM:REGION 39->61| TM:REGION 65->87| SEG 14->25|knklskknlykn| RP:PFM:NREP 1 RP:PFM:REP 32->84|PF09527|8e-05|34.0|53/61|ATPase_gene1| HM:PFM:NREP 1 HM:PFM:REP 45->86|PF09527|2.7e-07|23.8|42/61|ATPase_gene1| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------11-11111----1111-111111----------------------------11-------------------------------1----------------------------------------------------------------------------------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 13-34, 90-91| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //