[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20942.1
DDBJ      :             H+-transporting two-sector ATPase (subunit b')
Swiss-Prot:ATPF_PELUB   RecName: Full=ATP synthase subunit b;AltName: Full=ATP synthase F(0) sector subunit b;AltName: Full=F-type ATPase subunit b;         Short=F-ATPase subunit b;AltName: Full=ATPase subunit I;

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->59 PF02326 * YMF19 7e-07 46.8 %
:HMM:PFM   23->152 PF00430 * ATP-synt_B 6.5e-19 21.5 130/132  
:BLT:SWISS 1->179 ATPF_PELUB 3e-85 100.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20942.1 GT:GENE AAZ20942.1 GT:PRODUCT H+-transporting two-sector ATPase (subunit b') GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 128407..128946 GB:FROM 128407 GB:TO 128946 GB:DIRECTION + GB:PRODUCT H+-transporting two-sector ATPase (subunit b') GB:NOTE Old name Fo ATP Synthase Subunit b'; old EC 3.6.1.34 GB:PROTEIN_ID AAZ20942.1 GB:DB_XREF GI:71061939 LENGTH 179 SQ:AASEQ MEAFAAESGGMPQLNPEFWVSQIFWLIITFGILYVVLSKLILPKISANLENRKSQILENIEAAEKQREESEQKIEEYEKIVQSSKNEAKNYFKQAREKVLKDIGVKREILEKELDEEVNKAEIEIKTFRDNAPEKIKKIAVETSSDLLQELIGAEVNSSSISAIVEDLSRKKMDEYYGN GT:EXON 1|1-179:0| SW:ID ATPF_PELUB SW:DE RecName: Full=ATP synthase subunit b;AltName: Full=ATP synthase F(0) sector subunit b;AltName: Full=F-type ATPase subunit b; Short=F-ATPase subunit b;AltName: Full=ATPase subunit I; SW:GN Name=atpF; OrderedLocusNames=SAR11_0118; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(0);Complete proteome; Hydrogen ion transport; Ion transport; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|ATPF_PELUB|3e-85|100.0|179/179| GO:SWS:NREP 9 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| COIL:NAA 51 COIL:NSEG 1 COIL:REGION 47->97| TM:NTM 1 TM:REGION 23->45| SEG 64->80|ekqreeseqkieeyeki| RP:PFM:NREP 1 RP:PFM:REP 12->59|PF02326|7e-07|46.8|47/89|YMF19| HM:PFM:NREP 1 HM:PFM:REP 23->152|PF00430|6.5e-19|21.5|130/132|ATP-synt_B| GO:PFM:NREP 3 GO:PFM GO:0000276|"GO:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)"|PF02326|IPR003319| GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF02326|IPR003319| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF02326|IPR003319| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-111---1-1-11-1--------------11111111-111----1-11--1-1-----------1----------1----11-------------111111111111-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc //