[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20947.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:312 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->97 PF06609 * TRI12 4.7e-05 32.7 55/599  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20947.1 GT:GENE AAZ20947.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 132834..133772 GB:FROM 132834 GB:TO 133772 GB:DIRECTION + GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ20947.1 GB:DB_XREF GI:71061944 LENGTH 312 SQ:AASEQ MINNQIKKINFFHSIIFLFFSTSLALIFDQFKSLSISPIICLLLILSIGISHGALDNQKGKRLIKLYNINNIYYFYLIYLIIAATIIIIWLLAPTLSLIIFLVVAAYHFGKEDTEFLITKKSNIDIILYFLKGILIIIAPLMFHFVETINIFKLLLIQNESFYLFLNFIENNYIISFIFLISLLTNIYFFLKDFKLVNLLIFFDFTSILILNYFFTPLVAFTLYFCFLHSFRHSLSLITELDKYNFKNGLLIFIKKAAPLTILTAIFYLLSLYYLSNHYLVNEAIYKVIFIGLASLTFPHILLEYFLEKNEK GT:EXON 1|1-312:0| TM:NTM 8 TM:REGION 9->31| TM:REGION 33->55| TM:REGION 80->102| TM:REGION 130->152| TM:REGION 170->192| TM:REGION 201->223| TM:REGION 250->272| TM:REGION 284->306| SEG 33->51|slsispiiclllilsigis| SEG 63->93|liklyninniyyfyliyliiaatiiiiwlla| SEG 174->184|iisfiflisll| SEG 268->280|yllslyylsnhyl| HM:PFM:NREP 1 HM:PFM:REP 43->97|PF06609|4.7e-05|32.7|55/599|TRI12| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 310-312| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccEEEEEEEHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //