[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20964.1
DDBJ      :             DoxD-like family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  107/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->84 PF07681 * DoxX 3.3e-19 24.1 79/85  
:HMM:PFM   60->115 PF00146 * NADHdh 0.00092 23.2 56/311  
:BLT:SWISS 24->122 YPHA_SHIFL 4e-12 38.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20964.1 GT:GENE AAZ20964.1 GT:PRODUCT DoxD-like family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 145619..145999 GB:FROM 145619 GB:TO 145999 GB:DIRECTION + GB:PRODUCT DoxD-like family protein GB:PROTEIN_ID AAZ20964.1 GB:DB_XREF GI:71061961 LENGTH 126 SQ:AASEQ MNNILDLTGRILISLIFLLSGINKIGNYEGTVGWMESLGVPGIFLIPAIILEIGAPILIMIGYKVKVSAALLSIFCIATAVIFHNNLSDQMQFISFMKNIALAGGFLFLVVNETKDFSLDKKLNNR GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 24->122|YPHA_SHIFL|4e-12|38.4|99/140| TM:NTM 4 TM:REGION 5->27| TM:REGION 37->59| TM:REGION 69->91| TM:REGION 94->115| SEG 11->22|ilislifllsgi| HM:PFM:NREP 2 HM:PFM:REP 6->84|PF07681|3.3e-19|24.1|79/85|DoxX| HM:PFM:REP 60->115|PF00146|0.00092|23.2|56/311|NADHdh| OP:NHOMO 116 OP:NHOMOORG 108 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1-1-------21--12------------------------------------------------------------111--------211112-----1121-----1111-1-11---1-------1-------1-----------11-1-------------------------------------------------------------11------------------------1-1--------------11---2-1111112111-11111111111111111111-1--1-1----------------11-111----111111111111---------------------------------------1-111-----11---1-11---------------111----------12----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 125-126| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccc //