[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20965.1
DDBJ      :             Ferredoxin-dependent glutamate synthase peptide
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  655/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:512 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   184->445 1ofeA PDBj 5e-27 33.2 %
:RPS:PDB   102->422 2e77B PDBj 2e-18 13.6 %
:RPS:SCOP  151->481 1ea0A2  c.1.4.1 * 1e-58 27.3 %
:HMM:SCOP  86->500 1llwA2 c.1.4.1 * 7e-92 35.0 %
:RPS:PFM   20->40 PF09360 * zf-CDGSH 3e-05 66.7 %
:RPS:PFM   181->474 PF01645 * Glu_synthase 4e-49 38.4 %
:HMM:PFM   148->474 PF01645 * Glu_synthase 1.3e-93 38.5 327/368  
:HMM:PFM   8->41 PF09360 * zf-CDGSH 6.4e-17 63.6 33/38  
:HMM:PFM   44->77 PF09360 * zf-CDGSH 6.7e-14 39.4 33/38  
:BLT:SWISS 3->88 CISD3_MOUSE 1e-21 53.0 %
:BLT:SWISS 173->484 GLUS_METJA 4e-51 37.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20965.1 GT:GENE AAZ20965.1 GT:PRODUCT Ferredoxin-dependent glutamate synthase peptide GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 146096..147634 GB:FROM 146096 GB:TO 147634 GB:DIRECTION + GB:PRODUCT Ferredoxin-dependent glutamate synthase peptide GB:NOTE GltB-like protein GB:PROTEIN_ID AAZ20965.1 GB:DB_XREF GI:71061962 LENGTH 512 SQ:AASEQ MDKPTIADNKPKKVELVQNEEYMFCTCGKSKNQPFCDWSHAGTSFEPINFKAEETGDAYLCMCKHSSTKPYCDGTHKNFTSDQINKSEEVSGTNETKSTEEEPHLAYIHELAKNGLTKLGHHGEMGAMGVPSKDLPKWEDIQILTAQLAKKPLLDNDKVETDIIIGKNSNKPLTLKIPIFVSDMSFGALSEEAKIALAKGAEGAGTGICSGEGGMLLEEQKNNSKYFYELASAKFGYSEDKLKNIQAFHFKGGQAAKTGTGGHLPGNKVKGKISEVRQIPEGEDAISPSTFKDLTTVDDFLKFSNRVRELTGGIPIGFKLSAQHIEDDIEFAVSASADYIILDGRGGGTGAAPLIFRDNISVPTIPALARARNYLDKKGYDHVSLIVTGGLRTSADFVKALALGADGIAISNSAMQAIGCVGARMCNTNNCPAGIATQRPELRKKLNIDESSARLTRFFNASVDLMKILARACGHDHLNKLSINDLTTWKKEMSELSGVSFGGIINNKQNNK GT:EXON 1|1-512:0| BL:SWS:NREP 2 BL:SWS:REP 3->88|CISD3_MOUSE|1e-21|53.0|83/137| BL:SWS:REP 173->484|GLUS_METJA|4e-51|37.2|312/510| SEG 251->262|kggqaaktgtgg| BL:PDB:NREP 1 BL:PDB:REP 184->445|1ofeA|5e-27|33.2|262/1485| RP:PDB:NREP 1 RP:PDB:REP 102->422|2e77B|2e-18|13.6|302/368| RP:PFM:NREP 2 RP:PFM:REP 20->40|PF09360|3e-05|66.7|21/35|zf-CDGSH| RP:PFM:REP 181->474|PF01645|4e-49|38.4|294/342|Glu_synthase| HM:PFM:NREP 3 HM:PFM:REP 148->474|PF01645|1.3e-93|38.5|327/368|Glu_synthase| HM:PFM:REP 8->41|PF09360|6.4e-17|63.6|33/38|zf-CDGSH| HM:PFM:REP 44->77|PF09360|6.7e-14|39.4|33/38|zf-CDGSH| GO:PFM:NREP 4 GO:PFM GO:0043231|"GO:intracellular membrane-bounded organelle"|PF09360|IPR018967| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF09360|IPR018967| GO:PFM GO:0006537|"GO:glutamate biosynthetic process"|PF01645|IPR002932| GO:PFM GO:0015930|"GO:glutamate synthase activity"|PF01645|IPR002932| RP:SCP:NREP 1 RP:SCP:REP 151->481|1ea0A2|1e-58|27.3|319/763|c.1.4.1| HM:SCP:REP 86->500|1llwA2|7e-92|35.0|412/0|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 1340 OP:NHOMOORG 847 OP:PATTERN ---1--1111111111-11111111--111112131112111112-21111111-1-----1------ 11113--111111111111-14112411111245552376132211-11111121221--112111231211111111----211111--1111-----1-213222212---------------2113231123311111111112132112111111111112111111111111111111111111--122222222221222222111122222211-31211111142-2222222222222222122----11---------11----1-111--------11----------------------------------11-11-------1-11111------1--2111133112-2-121112---2-11111-----142432122223211111111111-22122122122-2222222222323321244111114241111111121112311-----------------------------5214112222222222222222222322222222211211222232111211222222211211-------222121111121211-2112-222222232111111--1--1-11111----------3111311111222522232232312322223233223---3224------111111-111111-111-1111111111111111111111111111111--1---11111121111111--111111111111---111111222213222-----------1---222221312222222232233343312221-111111-21113222222332222111111111111112-221222--------------------------------------1--1-111111 21----1-31--22111111111-1111111111111111-111111111111111111111111111-11-11111-1111111111-12111111111121222-3114121----------32---141---1-------1------1-------1---442213223233-1222V1111262351442242112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 443 STR:RPRED 86.5 SQ:SECSTR ############################################################HccccccccccccHHHHHHHHHHHHHHccccccccccccccccccTHHHHHHHTTccHHHHHHHHcccTTcHHHHHHHHGGGGEccEEccccccccccccccEEETTTccccEEEcccEEEcccccGGGTcTHHHHHHHHHHHHTccEEEETTccccHHHHHHHHTTccEEEEEcccccHHHHHTcccEEEEcccccccccHHHHHTTcccccccTTTGGGTTccGGGccHHHHHHHccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHTTccEEEEccGGGTcccHHHHHHTcccccccccHHHHHHHHHHHHTTcccEEEccccccHHHHHHHHHTTccEEEEcHHHHHHHHHHHcEEEEEcTTcHHHHTcccccccccccccEEEEHHHHHHHHHHHHHHHHHHTTcccHHHHHGGGTHHHHHHHHHHHTccEcc######### DISOP:02AL 1-2, 507-512| PSIPRED cccccEEccccEEEEEEcccEEEEEEccccccccccccccccccccEEEEEEEccccEEEEccccccccccccccccccHHHHHccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccccccccccccccccEEEcccccccccEEEccEEEEccccccccHHHHHHHHHHHHHcccEEEcccccccHHHHcccccEEEEcccccccccHHHHccHHEEEEEcccccccccccEEcHHHHHHHHHHHccccccccEEccccccccccHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHccccEEEEEccccccccHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHccccHHHHHHHHHHHccccccEEEcccccEEEEEccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHccHHHHHHcccccccccccHHccc //