[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20974.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->51 PF09866 * DUF2093 1e-06 51.4 %
:HMM:PFM   17->58 PF09866 * DUF2093 8.3e-24 45.2 42/42  
:BLT:SWISS 8->51 FABZ_NITEU 7e-04 53.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20974.1 GT:GENE AAZ20974.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(155552..155740) GB:FROM 155552 GB:TO 155740 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20974.1 GB:DB_XREF GI:71061971 LENGTH 62 SQ:AASEQ MNKKLAKLKYLPNNFEIIENGDHVVCAVSGKSISLENLNYWNVELQEPYFSYVEAHKKKETH GT:EXON 1|1-62:0| BL:SWS:NREP 1 BL:SWS:REP 8->51|FABZ_NITEU|7e-04|53.8|39/100| RP:PFM:NREP 1 RP:PFM:REP 17->51|PF09866|1e-06|51.4|35/42|DUF2093| HM:PFM:NREP 1 HM:PFM:REP 17->58|PF09866|8.3e-24|45.2|42/42|DUF2093| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------111-111111----1---------------------------------------------------------1--11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 58-62| PSIPRED cccccEEEEEccccEEEEEcccEEEEEEccccccHHHHccccHHHccccccHHHHHHHHccc //