[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20978.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->74 PF11233 * DUF3035 0.00022 20.6 68/157  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20978.1 GT:GENE AAZ20978.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(158728..159066) GB:FROM 158728 GB:TO 159066 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20978.1 GB:DB_XREF GI:71061975 LENGTH 112 SQ:AASEQ MVEKKSPLVLPPSFGELPEPGKEPEENIISDKKDTSDIEDIINQSSSISTSEKSDDAKNSIEQSIIKKINEKKVNLIETTEINLDEAIEENEKPKKKGFFKRLKDKFNKSDS GT:EXON 1|1-112:0| SEG 15->26|gelpepgkepee| SEG 40->56|diinqsssistseksdd| SEG 93->107|kpkkkgffkrlkdkf| HM:PFM:NREP 1 HM:PFM:REP 2->74|PF11233|0.00022|20.6|68/157|DUF3035| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 18-31, 44-63, 88-98, 107-112| PSIPRED cccccccEEEccccccccccccccHHHHHcccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHccccHHHHHHHHHHHHHccccc //