[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20988.1
DDBJ      :             membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  102/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->107 PF02588 * DUF161 3.7e-08 29.1 79/82  
:HMM:PFM   124->199 PF02588 * DUF161 9.7e-13 30.7 75/82  
:BLT:SWISS 4->177 Y522_HAEIN 2e-24 32.6 %
:TM
:REPEAT 2|46->104|142->200
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20988.1 GT:GENE AAZ20988.1 GT:PRODUCT membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(170199..170846) GB:FROM 170199 GB:TO 170846 GB:DIRECTION - GB:PRODUCT membrane protein GB:NOTE putative GB:PROTEIN_ID AAZ20988.1 GB:DB_XREF GI:71061985 LENGTH 215 SQ:AASEQ MFLKIKDIPKVYWSSEKPLNLKPKISTFFFLCLGLVLFGLGEGLLIVSFAGASPWSILAQGIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAIIIGLMIDVCIKFIPTPENYLNQLILATIAVLTVGLGGGIYLVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSIGWYLGGTVGIGTLLFAFGIGPSVALGLYLVGKTFN GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 4->177|Y522_HAEIN|2e-24|32.6|172/218| TM:NTM 5 TM:REGION 27->49| TM:REGION 62->84| TM:REGION 93->115| TM:REGION 123->145| TM:REGION 189->211| NREPEAT 1 REPEAT 2|46->104|142->200| SEG 28->45|ffflclglvlfglgegll| HM:PFM:NREP 2 HM:PFM:REP 28->107|PF02588|3.7e-08|29.1|79/82|DUF161| HM:PFM:REP 124->199|PF02588|9.7e-13|30.7|75/82|DUF161| OP:NHOMO 124 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- ----1---------1------1---2------1111-11-----1211111-111-----111-1112121---------1---------------------------------------------------------------11---------------------------------------1-------222222-22-221122-122111211-121-1-----12---------------------11-------------------------------------------------------------------1-11-1-------1-1-211---------1----11-----1---------------1--------------1---------------------------------------------------------------------1-----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-------------------------------111-------------------------------------------------------------1111-1-11-11111-----------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //