[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20990.1
DDBJ      :             amine oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   120->321 1yvvA PDBj 7e-14 22.8 %
:RPS:PDB   119->322 2b9wA PDBj 4e-06 10.0 %
:HMM:SCOP  1->166 1o5wA1 c.3.1.2 * 4.4e-15 20.1 %
:HMM:PFM   192->269 PF12278 * SDP_N 1.4e-05 27.6 76/168  
:HMM:PFM   3->154 PF07992 * Pyr_redox_2 1e-04 20.4 103/202  
:BLT:SWISS 165->198 YL066_MIMIV 7e-04 50.0 %
:REPEAT 2|83->149|168->240
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20990.1 GT:GENE AAZ20990.1 GT:PRODUCT amine oxidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(171583..172554) GB:FROM 171583 GB:TO 172554 GB:DIRECTION - GB:PRODUCT amine oxidase GB:NOTE flavin-containing (Fugue) GB:PROTEIN_ID AAZ20990.1 GB:DB_XREF GI:71061987 LENGTH 323 SQ:AASEQ MKDFCIIGSGISGATIANILNKKYSLDVYDKARGVGGRSSNKKLNKNESFDHGVQYISPKSIQFKKFIKSLILKKIVKKWPGKHLFLNTDKQEDKKHTKIIGKKGNNAISKYLLKDINCNFNSEVIKIFNKNKVWEIYFSDGSKKLYKSLILTCPFPQLKKLSKKYIKHSFINQKIKMDANITVMMATKKSKLNVSSYFFNDKILGWAGNENSKMRFKSKNDLWTLQSTYSWANKKIDKNRENKKLNTKIMIEQFFKLTGIKKTKVLFSLNHGWKYSSNSKPLRIKSYWNSSLNLGVCADWFVGPRLESGWISAQDLFNKINK GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 165->198|YL066_MIMIV|7e-04|50.0|34/100| NREPEAT 1 REPEAT 2|83->149|168->240| SEG 6->13|iigsgisg| SEG 60->79|ksiqfkkfikslilkkivkk| BL:PDB:NREP 1 BL:PDB:REP 120->321|1yvvA|7e-14|22.8|197/320| RP:PDB:NREP 1 RP:PDB:REP 119->322|2b9wA|4e-06|10.0|200/423| HM:PFM:NREP 2 HM:PFM:REP 192->269|PF12278|1.4e-05|27.6|76/168|SDP_N| HM:PFM:REP 3->154|PF07992|1e-04|20.4|103/202|Pyr_redox_2| HM:SCP:REP 1->166|1o5wA1|4.4e-15|20.1|149/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1----------------------------------------------11-11--1-------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-111111111111111----1------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 63.2 SQ:SECSTR ######################################################################################################################ccccccEEEEEccTTcEEEEEcccEEEEEcEEEEcccHHHHTTcGTccccHHHHHHHTTcEEEEEEEEEEEEccccccEEEcGGGGcGGGTTcccEEEEccTTcTTccEEEEEEcccTTcccccHHHHHHHHHHHHHHHTTccEEEEEEEEEEEEEEEccHHHHHTTHHHHHHHTGEEEccGGGccccHHHHHHHHHHHHHHHT# DISOP:02AL 87-99, 214-217| PSIPRED ccEEEEEcccHHHHHHHHHHHcccEEEEEEccccccccEEEEEccccEEEEEccEEEccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEccEEEEEEEcccEEEEEEcccccEEccEEEEEccccHHHHHHccccccHHHHHcccccHHHHHHHHcccccccccEEEcccccHHHHHcccccccccccccEEEEEEcHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHEEEEccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHcc //