[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20994.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->102 PF04134 * DUF393 4.8e-19 27.3 99/113  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20994.1 GT:GENE AAZ20994.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 175765..176112 GB:FROM 175765 GB:TO 176112 GB:DIRECTION + GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20994.1 GB:DB_XREF GI:71061991 LENGTH 115 SQ:AASEQ MKVYFNNSCKICRAEINLYKKQNIKDIEWVDITNNKSAEIETQRNAKNLLRRLHIKDGEKVIGGAEAFLLVWKKIPKYKFLYSFFKTPIIFTLFSFFYEIIAFFLFLKNKKQLLK GT:EXON 1|1-115:0| TM:NTM 2 TM:REGION 63->85| TM:REGION 87->108| SEG 103->114|fflflknkkqll| HM:PFM:NREP 1 HM:PFM:REP 3->102|PF04134|4.8e-19|27.3|99/113|DUF393| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 113-115| PSIPRED cEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHcccccccEEEcHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccc //