[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ20996.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:391 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 229->308 CT152_MOUSE 8e-04 27.5 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20996.1 GT:GENE AAZ20996.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(176702..177877) GB:FROM 176702 GB:TO 177877 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ20996.1 GB:DB_XREF GI:71061993 LENGTH 391 SQ:AASEQ MKKIKKNLAKKKPLAKKKVKKTTNKKQKKNLKIKKNIYNKKKISKNTKTNKKKQKTYSKKKATLISRVVELQNSLKPEFNFKINFSLERYIQAFFDNIANRISEYKTLKAEEKRRRQLEEIEKKEQEKLQIQKQKVKEEQEQTKLKEKALKEEIKLEKERARDIKLFLRKEQALLRIEHAERQKQFLKQLQLEKQIEKFRIREIKELEKLEKISLKEKRDDYAGLQARIEKLKDKYRIIRDQKIRERVEALGVKIQGDEDRDTLLQKEKDYKVARQKIELSLESFYRSASSLVFQLNKRHITRHMSIFRCIDQRFETGEIFIKWDEAPDEEWLLLIYIKNNSPDEGIVIEDKSDPEKNLSHEFKSNEIFKASDLMVDSLTQLISRKRAKKD GT:EXON 1|1-391:0| BL:SWS:NREP 1 BL:SWS:REP 229->308|CT152_MOUSE|8e-04|27.5|80/100| COIL:NAA 50 COIL:NSEG 1 COIL:REGION 106->155| SEG 2->64|kkikknlakkkplakkkvkkttnkkqkknlkikkniynkkkiskntktnkkkqktyskkkatl| SEG 111->159|eekrrrqleeiekkeqeklqiqkqkvkeeqeqtklkekalkeeikleke| SEG 183->219|qkqflkqlqlekqiekfrireikeleklekislkekr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-30, 42-61, 111-120, 134-155, 184-195, 213-214, 218-221, 251-258, 352-361, 387-391| PSIPRED ccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEEEcccccccEEEccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccc //