[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21000.1
DDBJ      :             Heat shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.3
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   111->148 2ctwA PDBj 3e-05 47.2 %
:BLT:PDB   119->167 2ys8A PDBj 8e-04 34.7 %
:RPS:PDB   114->163 3bvoB PDBj 9e-06 24.0 %
:RPS:SCOP  114->162 1fpoA1  a.2.3.1 * 1e-05 16.3 %
:HMM:SCOP  104->162 1gh6A_ a.2.3.1 * 4e-07 29.3 %
:HMM:PFM   113->162 PF00226 * DnaJ 2.6e-10 33.3 48/64  
:HMM:PFM   6->80 PF07690 * MFS_1 0.00026 23.0 74/353  
:BLT:SWISS 109->148 DNAJ_TETHA 2e-04 42.1 %
:BLT:SWISS 119->163 DNAJ_PEDPA 2e-05 44.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21000.1 GT:GENE AAZ21000.1 GT:PRODUCT Heat shock protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(180750..181256) GB:FROM 180750 GB:TO 181256 GB:DIRECTION - GB:PRODUCT Heat shock protein GB:NOTE DnaJ N Terminal End Only GB:PROTEIN_ID AAZ21000.1 GB:DB_XREF GI:71061997 LENGTH 168 SQ:AASEQ MNIIIYTLIFLGITYFLLKLVANTSSKKISKHLRKLIFLGLIILAILLFVAGKFLLSIPLTLLSLALVKLKGFSIFQLIGLFRLIQTLRNSGRFSFNQNQNIKNSSTITIEEAYKILNLDIKKKITKDDVQKAYIKIQKKIHPDISPETTRLSMIVNEAKEVVLKNLV GT:EXON 1|1-168:0| BL:SWS:NREP 2 BL:SWS:REP 109->148|DNAJ_TETHA|2e-04|42.1|38/386| BL:SWS:REP 119->163|DNAJ_PEDPA|2e-05|44.4|45/374| TM:NTM 3 TM:REGION 2->24| TM:REGION 36->58| TM:REGION 61->83| SEG 36->52|liflgliilaillfvag| SEG 55->70|llsipltllslalvkl| BL:PDB:NREP 2 BL:PDB:REP 111->148|2ctwA|3e-05|47.2|36/109| BL:PDB:REP 119->167|2ys8A|8e-04|34.7|49/90| RP:PDB:NREP 1 RP:PDB:REP 114->163|3bvoB|9e-06|24.0|50/172| HM:PFM:NREP 2 HM:PFM:REP 113->162|PF00226|2.6e-10|33.3|48/64|DnaJ| HM:PFM:REP 6->80|PF07690|0.00026|23.0|74/353|MFS_1| RP:SCP:NREP 1 RP:SCP:REP 114->162|1fpoA1|1e-05|16.3|49/76|a.2.3.1| HM:SCP:REP 104->162|1gh6A_|4e-07|29.3|58/0|a.2.3.1|1/1|Chaperone J-domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 45.2 SQ:SECSTR ###########################################################################################cccccccccccccccccccccHHHHHTccccccccHHHHHHHHHHHHHHHcGGGGTHHHHHHHHHHHHHHHHccHH# DISOP:02AL 126-127| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcc //