[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21006.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:98 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->94 2fiuA PDBj 2e-11 37.8 %
:RPS:PDB   7->95 3dcaA PDBj 6e-10 16.1 %
:RPS:SCOP  2->94 2fiuA1  d.58.4.16 * 8e-21 35.9 %
:HMM:SCOP  1->95 2fiuA1 d.58.4.16 * 9.7e-27 42.9 %
:RPS:PFM   16->75 PF07045 * DUF1330 2e-08 41.7 %
:HMM:PFM   15->76 PF07045 * DUF1330 1.2e-24 41.9 62/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21006.1 GT:GENE AAZ21006.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 186287..186583 GB:FROM 186287 GB:TO 186583 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21006.1 GB:DB_XREF GI:71062003 LENGTH 98 SQ:AASEQ MKAYWIALYKRIDSQENLKNYGAKVTGIIKSYGGKPLVRGGKFETLEGETYPRTVIWEFPNYEQAMKCHDSKEYQDGWAIARDTTERNLQIVEGFSTE GT:EXON 1|1-98:0| BL:PDB:NREP 1 BL:PDB:REP 2->94|2fiuA|2e-11|37.8|90/93| RP:PDB:NREP 1 RP:PDB:REP 7->95|3dcaA|6e-10|16.1|87/127| RP:PFM:NREP 1 RP:PFM:REP 16->75|PF07045|2e-08|41.7|60/65|DUF1330| HM:PFM:NREP 1 HM:PFM:REP 15->76|PF07045|1.2e-24|41.9|62/65|DUF1330| RP:SCP:NREP 1 RP:SCP:REP 2->94|2fiuA1|8e-21|35.9|92/95|d.58.4.16| HM:SCP:REP 1->95|2fiuA1|9.7e-27|42.9|91/0|d.58.4.16|1/1|Dimeric alpha+beta barrel| OP:NHOMO 66 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------111---11-1111111111111---1--1-111--1111112111-1-----122----221---------------------------------------------1-----------------------11----------------1----------1---1-----------------1--------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1---------------111-1-1-----------111-----11-------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 95.9 SQ:SECSTR #cEEEEcccccccHHHHHHHHHHHHHHHHHHHTcEEEEEEccccccccTTccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEccc### PSIPRED ccEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEcccEEEEcccccccEEEEEEccHHHHHHHHccHHHHHHHHHHHHccEEEEEEEEccccc //