[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21013.1
DDBJ      :             soluble lytic murein transglycosylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.2.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->166 1dkkA PDBj 3e-09 12.8 %
:RPS:SCOP  39->163 1qsaA2  d.2.1.6 * 5e-08 17.9 %
:HMM:SCOP  32->196 153lA_ d.2.1.5 * 5.3e-14 14.7 %
:HMM:PFM   44->165 PF01464 * SLT 0.00036 20.8 106/121  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21013.1 GT:GENE AAZ21013.1 GT:PRODUCT soluble lytic murein transglycosylase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(193367..193966) GB:FROM 193367 GB:TO 193966 GB:DIRECTION - GB:PRODUCT soluble lytic murein transglycosylase GB:NOTE similar to slt domain (Fugue) GB:PROTEIN_ID AAZ21013.1 GB:DB_XREF GI:71062010 LENGTH 199 SQ:AASEQ MSKLKNHFLILLIIFIAGCSSIPQNTSNSCSIFNERYLWYKHAKKTEQKWGTPIYIQLAIIKMESDFDWLAKPPRQKLFKIIPFKRPSSSFGYSQAVKGTWEQYKNETGNKLATRTRFKDSVDFIGWYTDKTESLLKISKKDAFRQYLAYHEGWGGYKDYKNNQKVIGLAKKVEKQSNKYKSQLQDCQKRLNKNKYIIF GT:EXON 1|1-199:0| TM:NTM 1 TM:REGION 5->27| RP:PDB:NREP 1 RP:PDB:REP 32->166|1dkkA|3e-09|12.8|125/129| HM:PFM:NREP 1 HM:PFM:REP 44->165|PF01464|0.00036|20.8|106/121|SLT| RP:SCP:NREP 1 RP:SCP:REP 39->163|1qsaA2|5e-08|17.9|112/168|d.2.1.6| HM:SCP:REP 32->196|153lA_|5.3e-14|14.7|143/0|d.2.1.5|1/1|Lysozyme-like| OP:NHOMO 131 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-------------11111111111---------11--111111111111--1--1111111111---------------------------------------------1------1111---------------------------------------------------------------------1-------------------------------------------------------111111111111111111111111111111--1111---------------------------------------------------------------------------------------------111111111111-----------------------------11-111-11---------22222222211111-----11111--------------111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 78.9 SQ:SECSTR #############################cccccHHHHHHHHHTTcTTcTTccHHHHHHHHHHHHTTcTTcEEEcT####EEETTTccEEETTTTEETTTTcccccccTTcccTTcccGGGGGccccHHHHHHHHHHHTcccGGGGcHHHHHHTTTcGGGGTTcccHHHHcHHHHHHcHHHHccTTcccc######### DISOP:02AL 1-2, 193-195| PSIPRED cHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //