[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21017.1
DDBJ      :             Phosphotransferase enzyme family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  258/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:321 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->293 3csvA PDBj 1e-22 33.0 %
:RPS:PDB   31->243 1avqA PDBj 9e-11 5.0 %
:RPS:SCOP  161->294 1zylA1  d.144.1.6 * 1e-10 16.1 %
:HMM:SCOP  10->237 1j7lA_ d.144.1.6 * 2.1e-18 20.1 %
:RPS:PFM   179->219 PF01636 * APH 1e-05 46.3 %
:HMM:PFM   8->238 PF01636 * APH 2.4e-19 22.8 206/238  
:HMM:PFM   239->297 PF02665 * Nitrate_red_gam 0.00063 25.4 59/223  
:BLT:SWISS 9->192 RPOC2_HELSJ 6e-06 33.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21017.1 GT:GENE AAZ21017.1 GT:PRODUCT Phosphotransferase enzyme family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(195792..196757) GB:FROM 195792 GB:TO 196757 GB:DIRECTION - GB:PRODUCT Phosphotransferase enzyme family protein GB:PROTEIN_ID AAZ21017.1 GB:DB_XREF GI:71062014 LENGTH 321 SQ:AASEQ MLQTNDKLKKIKGDASFRSFYRKSLSKKKSIIVFASKEKEKNLLIYDAINSLLIKNKVLAPKLYSENYKKNYIEIEDFGDDSVFSLLKKNKNQKETLYKKSIDLLGVIQKIKQNRSKNFKGKTYKIPIYDNVKLFNEANLFCEWYAKKFVKQNKLAKFKIDIKKQIRFLLTHLQSKEKVFVHRDFHVSNLMKFKNKIGVIDSQDALIGNRAYDLASLIDDVRFRTDEIFKNKIYRYYLKLNKKRVNKATLLSDFEILSILRNMKIIGIFTRLAMRDKKKQYLKLIPYAWKLIELRISNNKKFSELKSLLELNFSKKIRNQK GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 9->192|RPOC2_HELSJ|6e-06|33.6|149/1058| SEG 297->316|snnkkfselksllelnfskk| BL:PDB:NREP 1 BL:PDB:REP 58->293|3csvA|1e-22|33.0|215/316| RP:PDB:NREP 1 RP:PDB:REP 31->243|1avqA|9e-11|5.0|200/228| RP:PFM:NREP 1 RP:PFM:REP 179->219|PF01636|1e-05|46.3|41/221|APH| HM:PFM:NREP 2 HM:PFM:REP 8->238|PF01636|2.4e-19|22.8|206/238|APH| HM:PFM:REP 239->297|PF02665|0.00063|25.4|59/223|Nitrate_red_gam| RP:SCP:NREP 1 RP:SCP:REP 161->294|1zylA1|1e-10|16.1|124/325|d.144.1.6| HM:SCP:REP 10->237|1j7lA_|2.1e-18|20.1|219/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 258 OP:NHOMOORG 258 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------11---------------------------------11-111-1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1-111111111111111111111111-11111111111-111111111111111111-1----111------------11-1-----------------------------11111-111111111111111111111111111111111111111111111-1-1111111111111111111111111111---------------------1-1--1--------------------1---111111-11-111-1111111111111111111--111-1--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111---------1--------------111111111111111-1-1111--------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 80.1 SQ:SECSTR ##############################HcccGGGccTTcHHHHHTTTTcEETTTGGGTTccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHH######HHHHHcccEEccccEEccTTccEEcEEccHHETTccEEEEEccccHHHHHHHHHHcGGGccHHHHHHHHHHHHHHTccEEEEEEEcTTcccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTTGGHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHc############################ DISOP:02AL 1-5, 315-321| PSIPRED cccccccHHcccccccccEEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHcccccHHHHHccHHccccHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccEEEcccccEEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHccc //