[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21035.1
DDBJ      :             multi-domain protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:248 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  135->225 2evrA2  d.3.1.16 * 2e-11 25.6 %
:HMM:SCOP  115->243 2evrA2 d.3.1.16 * 6.9e-24 25.0 %
:RPS:PFM   142->215 PF00877 * NLPC_P60 8e-06 31.5 %
:HMM:PFM   141->227 PF00877 * NLPC_P60 1.1e-15 31.8 85/105  
:HMM:PFM   16->61 PF08239 * SH3_3 4.6e-09 31.8 44/52  
:HMM:PFM   62->138 PF05538 * Campylo_MOMP 0.00051 24.3 74/431  
:BLT:SWISS 137->236 YKFC_BACSU 4e-08 34.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21035.1 GT:GENE AAZ21035.1 GT:PRODUCT multi-domain protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 215418..216164 GB:FROM 215418 GB:TO 216164 GB:DIRECTION + GB:PRODUCT multi-domain protein GB:NOTE SH3 and NLP/P60 domains (Pfam) GB:PROTEIN_ID AAZ21035.1 GB:DB_XREF GI:71062032 LENGTH 248 SQ:AASEQ MKDNYFYKKPLSNIYKKPNAFSEVTSQILYGEKFKIISKNKNWIKIKVSFDNYTGYIKNKYYTKDHQPTHKIFTLKANIYNKQKNKTKNFLPFASRISMIDENKKFIEFEKNKWIKKKDIKKINHIEKDYLKVLKMFLKIKYLWGGKTYRGIDCSAILQLFFYYNNKFYPRDTKDQIKYSAKKNKSKVFKKGDIIFWKGHVAVCINAQKLIHAYGPEKKVLIMNIKETINRIERTAKLTVKKISPIKY GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 137->236|YKFC_BACSU|4e-08|34.3|99/296| SEG 33->47|kfkiisknknwikik| SEG 100->129|idenkkfiefeknkwikkkdikkinhiekd| SEG 178->191|kysakknkskvfkk| RP:PFM:NREP 1 RP:PFM:REP 142->215|PF00877|8e-06|31.5|73/100|NLPC_P60| HM:PFM:NREP 3 HM:PFM:REP 141->227|PF00877|1.1e-15|31.8|85/105|NLPC_P60| HM:PFM:REP 16->61|PF08239|4.6e-09|31.8|44/52|SH3_3| HM:PFM:REP 62->138|PF05538|0.00051|24.3|74/431|Campylo_MOMP| RP:SCP:NREP 1 RP:SCP:REP 135->225|2evrA2|2e-11|25.6|90/148|d.3.1.16| HM:SCP:REP 115->243|2evrA2|6.9e-24|25.0|128/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 63 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------1------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11-11-1-111-111111111111--1-1-1-11111-----------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 184-187, 247-248| PSIPRED cccEEEEEEccccHHccccccccHHHHHHcccEEEEEEEEccEEEEEEEcccEEEEEEHHHcccccccEEEEEEEccEEEccccccEEccccccEEEEEEcccccEEEcccccEEEHHHcccccHHHHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHccccccccHHHHHHHccccccHHHcccccEEEEccEEEEEEcccEEEEEccccccEEEEEcccHHHHHHHHHccccHHcccccc //