[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21081.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:187 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->66 PF06124 * DUF960 3.9e-05 28.3 53/97  
:HMM:PFM   121->170 PF08568 * Kinetochor_Ybp2 0.00037 18.4 49/619  
:BLT:SWISS 48->110 SYV_CHLPN 3e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21081.1 GT:GENE AAZ21081.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(262083..262646) GB:FROM 262083 GB:TO 262646 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21081.1 GB:DB_XREF GI:71062078 LENGTH 187 SQ:AASEQ MKKIVRTLFIIIFVANFTYADEKDYSADNFFHIGQMNSHDENFSLYFKTREKPILARGEESNYITDFPQDLYIYNYKTKTSLPLISYEWFPSKAKFFLEEYDFPVFPEDFAYYLLKDNNTLVMISAIKNINKNFQFDITNKKLNQYPSSGKFEFIISSIAKNCGHSQLKENYKCNYYKPLISNNLIN GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 48->110|SYV_CHLPN|3e-04|33.3|63/100| HM:PFM:NREP 2 HM:PFM:REP 13->66|PF06124|3.9e-05|28.3|53/97|DUF960| HM:PFM:REP 121->170|PF08568|0.00037|18.4|49/619|Kinetochor_Ybp2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccEEEEEEEccccEEEEcccccEEccccccEEEEEEEccccccEEEEEccccHHHHHHHHccccccccccEEEEEEcccEEEEEEEHHcccccEEEEEEccHHHcccccccHHHHHHHHHHHccHHHHHHcccccEEcHHHcccccc //