[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21083.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->58 PF07695 * 7TMR-DISM_7TM 0.00017 23.5 51/205  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21083.1 GT:GENE AAZ21083.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(263611..263790) GB:FROM 263611 GB:TO 263790 GB:DIRECTION - GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21083.1 GB:DB_XREF GI:71062080 LENGTH 59 SQ:AASEQ MLNKITTLIGSGLATLFLIGLATTLTRSSMIGFWDILPVFILMAVAIFMMFYEAFFDKN GT:EXON 1|1-59:0| TM:NTM 2 TM:REGION 3->25| TM:REGION 32->54| HM:PFM:NREP 1 HM:PFM:REP 8->58|PF07695|0.00017|23.5|51/205|7TMR-DISM_7TM| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //