[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21092.1
DDBJ      :             putative ABC transporter solute-binding protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  92/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:511 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   157->490 1eu8A PDBj 6e-18 32.9 %
:RPS:PDB   76->490 1a7lA PDBj 9e-17 17.9 %
:RPS:SCOP  76->499 1j1nA  c.94.1.1 * 7e-21 11.4 %
:HMM:SCOP  42->504 1y3nA1 c.94.1.1 * 1.8e-51 25.9 %
:RPS:PFM   79->339 PF01547 * SBP_bac_1 8e-05 31.9 %
:HMM:PFM   76->382 PF01547 * SBP_bac_1 3.2e-07 23.0 239/314  
:BLT:SWISS 51->388 Y4OP_RHISN 6e-07 24.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21092.1 GT:GENE AAZ21092.1 GT:PRODUCT putative ABC transporter solute-binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(272358..273893) GB:FROM 272358 GB:TO 273893 GB:DIRECTION - GB:PRODUCT putative ABC transporter solute-binding protein GB:PROTEIN_ID AAZ21092.1 GB:DB_XREF GI:71062089 LENGTH 511 SQ:AASEQ MKIIKTCLSAMISGILIFSPAYADKWSDQFPHIKATGDIPGDCSYEEISKKNYKGKTLKINTHAVPVIGQPTALHAEQFAKLTGATVDVTHTPAGDLYAKAMVPFKAGQAPYDIVFGFSNFINDWRQYLAPVPKKYMNTKEMKDVTKSHVGVSSWDGTMYQYPVDGDRHYLKYRKDVIDNPEMQKKYKADTGKELKVPTTWKEYGEMAKYFNGWDWDGDGEKEYGSAEVMKKDDLMFAAFFSRSVAYAKNPRTPGGFFFDLETMKPNVNNPGFVEALTDWVEATKYVPPGGINFGLGDEIGSFGGGQTLFSFSWDDAFIAAMQDDSPIKNKVGTAPLPGADKVWNRVTGKWENQYNQAPYIVWGWAVGVAKKSKVQEMAFDYLCFFSNGANHQADLAIGNFGVNPFKNSDFDPNLYIDTMGWDKEIAESYTKTLKDMEKSKNRVFPLRVRGVFEFTSAVATGTSKALAGQLSPQEALDEVAKEWEAIVKRVGKSAVQEDYAVGVKMEDNKL GT:EXON 1|1-511:0| BL:SWS:NREP 1 BL:SWS:REP 51->388|Y4OP_RHISN|6e-07|24.6|289/431| TM:NTM 1 TM:REGION 1->23| BL:PDB:NREP 1 BL:PDB:REP 157->490|1eu8A|6e-18|32.9|286/407| RP:PDB:NREP 1 RP:PDB:REP 76->490|1a7lA|9e-17|17.9|351/380| RP:PFM:NREP 1 RP:PFM:REP 79->339|PF01547|8e-05|31.9|226/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 76->382|PF01547|3.2e-07|23.0|239/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 76->499|1j1nA|7e-21|11.4|395/492|c.94.1.1| HM:SCP:REP 42->504|1y3nA1|1.8e-51|25.9|428/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 150 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------1------------ -------------------------1------------------1-------121------------1-1---------------------------------------------------------------------------2-1----------------------------------------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1----------------212---21111----------1---1-----13--2--364366522-----1211212312--------------11-----------------------------1------1111-------------12---------1111--1111-1--1-2112------------------------1---1--------------------------------------------------------------1-------1---------1----------------------------------------------------------------------------------------------------------------221---------------------------------1111111-111-------------------------------------------------------------------------------------11--21-32--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------31---------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 437 STR:RPRED 85.5 SQ:SECSTR ########################################################################HHHHHHHHHHHcccEEEEccTTHHHHHHHHGGHHGGTccccEEEEEGGGHHHHHHTTccccccccHHHHTTccHHHHGGGEEETTEEccEEEEEEccEEEEETTTccccHcTTHHHHHHHTTcccccccTTHHHHHHHHHTTTcEEEcTTTccccccccccHHHHHHHHHHTTcEEETcEEEcccccccccccEEcccHHHHHHHHHHHHHHHTTcccTTcccHHHHHHHHHTTcccEEEEcGGGHHHHHHHTccETccEEEEcccccTTcccEcTTcccccEcccccEEEEEEEEEcTTcTTHHHHHHHHHHTTccHHHHHHHHHHHccccEEccHHHHHHccEEccHHHHHHHTTcHHHHHHHHHHHHcEEccccTTHHHHHHHHHHHHHHHHTTcccHHHHHHHHHccHHHHcccHHHccGGGGGEETTTTEEc## DISOP:02AL 1-5, 26-41, 508-511| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEHHHHHccccccHHHHHccccccccccHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEEccccEEEEccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEEEEEccHHHHHHHcccccccccEEEEEccccccccccccccccccccccccEEcEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //