[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21102.1
DDBJ      :             Unknown protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->169 PF09411 * PagL 3.8e-22 23.6 123/139  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21102.1 GT:GENE AAZ21102.1 GT:PRODUCT Unknown protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(284844..285353) GB:FROM 284844 GB:TO 285353 GB:DIRECTION - GB:PRODUCT Unknown protein GB:PROTEIN_ID AAZ21102.1 GB:DB_XREF GI:71062099 LENGTH 169 SQ:AASEQ MKHYKLISRFIFIIFFSLLSSVVYAEENSSKFNVYSGMFDFSDTGKKSTLIGFQHQNEDLNRDTFLGNISPITGALVTADSAAYIYTGVQAQYKLGKINFTPSFAPGLYSKGDGKDLGHILEFKSELQISVDFVSNSQLGFSYNHLSNASLGTKNPGANSYMFNFFKTF GT:EXON 1|1-169:0| TM:NTM 1 TM:REGION 4->26| SEG 6->21|lisrfifiiffsllss| HM:PFM:NREP 1 HM:PFM:REP 47->169|PF09411|3.8e-22|23.6|123/139|PagL| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHEEccccccEEEEEEcEEccccccccEEEEEEEcccccccccEEEccccHHHHHHHHHcccEEEEHHEEEEEEEccEEEEEEEEccEEcccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEccccccccccEEEEEEEEEccc //