[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21111.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->101 PF10984 * DUF2794 7e-15 42.5 %
:HMM:PFM   21->104 PF10984 * DUF2794 5.1e-33 40.5 84/85  
:BLT:SWISS 4->65 PT1_BUCAP 1e-05 41.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21111.1 GT:GENE AAZ21111.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 290618..290962 GB:FROM 290618 GB:TO 290962 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21111.1 GB:DB_XREF GI:71062108 LENGTH 114 SQ:AASEQ MNRNLKLVVNNPHKQIEERQFFEKNELKIILDLYAKMVSEGSWKDYGLNISNRQVSFSVFKNAAENALYKICKNFKPSNKNLKYLITDSNGKVLKNSFDLEILLKNTNWKNLKK GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 4->65|PT1_BUCAP|1e-05|41.0|61/100| SEG 103->113|llkntnwknlk| RP:PFM:NREP 1 RP:PFM:REP 22->101|PF10984|7e-15|42.5|80/85|DUF2794| HM:PFM:NREP 1 HM:PFM:REP 21->104|PF10984|5.1e-33|40.5|84/85|DUF2794| OP:NHOMO 61 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------111111111111111111111111-11111111--1-11111111111111---1111111111---------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 111-114| PSIPRED cccEEEEEEccccccccHHHHccHHHHHHHHHHHHHHHHccccHHccccccccEEEEHEEHHHccccEEEEEEccccccccccEEEEccccEEEEcccHHHHHHHccccccccc //