[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21117.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->114 PF11190 * DUF2976 0.00044 21.4 56/87  
:HMM:PFM   24->76 PF10003 * DUF2244 9.3e-05 22.6 53/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21117.1 GT:GENE AAZ21117.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 295195..295653 GB:FROM 295195 GB:TO 295653 GB:DIRECTION + GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21117.1 GB:DB_XREF GI:71062114 LENGTH 152 SQ:AASEQ MEALKNWMKDAANILFDDSKNDLRSLPRSVRLQILLVLSFVWTTVFSLYIFSYTTFAFGWAGLYVAHIGLIFAVYMTFKHFHKAEAQSSSVFKTKNFDPFKIMVIVFVIVFIFVFSKGIEILTSPNPSSYSIPYDGPVKSVFEKWLPFSKDK GT:EXON 1|1-152:0| TM:NTM 3 TM:REGION 28->50| TM:REGION 56->78| TM:REGION 99->121| SEG 100->115|fkimvivfvivfifvf| HM:PFM:NREP 2 HM:PFM:REP 53->114|PF11190|0.00044|21.4|56/87|DUF2976| HM:PFM:REP 24->76|PF10003|9.3e-05|22.6|53/140|DUF2244| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 150-152| PSIPRED cHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHccccccc //