[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21120.1
DDBJ      :             possible transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->72 PF04973 * NMN_transporter 0.00015 26.6 64/182  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21120.1 GT:GENE AAZ21120.1 GT:PRODUCT possible transmembrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(297179..297400) GB:FROM 297179 GB:TO 297400 GB:DIRECTION - GB:PRODUCT possible transmembrane protein GB:PROTEIN_ID AAZ21120.1 GB:DB_XREF GI:71062117 LENGTH 73 SQ:AASEQ MNNKFFEWAGVITAILYSMFVALNIGIEFLGFCLLLLSAILIGIWAYRGGHKGILVLQFFYATAGIIGMIRWF GT:EXON 1|1-73:0| TM:NTM 2 TM:REGION 15->37| TM:REGION 52->73| HM:PFM:NREP 1 HM:PFM:REP 6->72|PF04973|0.00015|26.6|64/182|NMN_transporter| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc //