[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21135.1
DDBJ      :             Uncharacterized conserved protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  304/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->137 2gbsA PDBj 4e-37 48.9 %
:RPS:PDB   1->135 2ar1A PDBj 6e-39 40.6 %
:RPS:SCOP  2->131 1zceA1  b.122.1.8 * 2e-44 41.5 %
:HMM:SCOP  1->136 1zceA1 b.122.1.8 * 3.2e-48 51.9 %
:RPS:PFM   2->131 PF01878 * DUF55 9e-33 54.7 %
:HMM:PFM   2->133 PF01878 * DUF55 5.6e-48 53.8 130/143  
:BLT:SWISS 2->131 THYN1_MOUSE 5e-20 43.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21135.1 GT:GENE AAZ21135.1 GT:PRODUCT Uncharacterized conserved protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 309643..310056 GB:FROM 309643 GB:TO 310056 GB:DIRECTION + GB:PRODUCT Uncharacterized conserved protein GB:PROTEIN_ID AAZ21135.1 GB:DB_XREF GI:71062132 LENGTH 137 SQ:AASEQ MNYWLMKSEPDVWSIDQQKKAGAKGAPWDGVRNYQAAKNLRAMKKGDLCFFYHSNIGKEIVGTVEVIKEAFLDKTDKDGRFVAVQVKFKEKLRKSVTLEEIKKTKSLSHLSLIRQSRLSVMPIDSKSWKILNKMSSI GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 2->131|THYN1_MOUSE|5e-20|43.8|130/226| BL:PDB:NREP 1 BL:PDB:REP 3->137|2gbsA|4e-37|48.9|135/145| RP:PDB:NREP 1 RP:PDB:REP 1->135|2ar1A|6e-39|40.6|133/157| RP:PFM:NREP 1 RP:PFM:REP 2->131|PF01878|9e-33|54.7|128/142|DUF55| HM:PFM:NREP 1 HM:PFM:REP 2->133|PF01878|5.6e-48|53.8|130/143|DUF55| RP:SCP:NREP 1 RP:SCP:REP 2->131|1zceA1|2e-44|41.5|130/146|b.122.1.8| HM:SCP:REP 1->136|1zceA1|3.2e-48|51.9|133/0|b.122.1.8|1/1|PUA domain-like| OP:NHOMO 440 OP:NHOMOORG 416 OP:PATTERN ------------------------------------------------------------------11 111---------------------------------------------------------------------------------1-11-----------------111-1--------------------------11111---1---1111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-1---111111111111111111111111111111-11111111111111111111111111-1-11111111111111111111111111--111111-----------------1-1111111------1111111-11111111111111111111--1111-1--1-1-1-11-11111--------111-111-----1111-111111111111111111----------------------------11---111--11-1111111-1111-1--1------111--------------------------------------------------------------------------------------------111111----111-1-----------------------1-111111111111111-111-------------1-----111-111111111111111----111111-----------------------------------------------1- --------211----1111111111111111111111111111---1-111---1-111111-----------1------------1---1111111111--------1-1111112-1-11111-131465-21211--11111-11--1--111111----11--------11111-6---1111-111-11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEcTTTccHHHHHHHcEEcEEccccccHHHHHHHHHccTTcEEEEEEcccccEEEEEEEEEEEEEEcGGccccccEEEEEEEEEEEEEEEEHHHHTTcGGGTTcHHHHcccccEEEEcHHHHHHHHHHHTc PSIPRED ccEEEEEEccccccHHHHHHcccccccccccccHHHHHHHHHHccccEEEEEEccccccEEEEEEEEEccccccccccccEEEEEEEEcHHccccccHHHHHccccccccEEEcccccccEEccHHHHHHHHHHccc //