[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21142.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:536 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->278 2nm1A PDBj 7e-04 27.0 %
:RPS:PDB   59->413 1ddqC PDBj 2e-06 8.2 %
:RPS:PFM   302->431 PF07940 * Hepar_II_III 8e-06 27.7 %
:HMM:PFM   301->446 PF07940 * Hepar_II_III 1.1e-25 31.5 127/139  
:BLT:SWISS 29->187 YEJM_ECOLI 8e-05 29.2 %
:BLT:SWISS 274->405 KI15A_XENLA 2e-04 26.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21142.1 GT:GENE AAZ21142.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 316069..317679 GB:FROM 316069 GB:TO 317679 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID AAZ21142.1 GB:DB_XREF GI:71062139 LENGTH 536 SQ:AASEQ MILNNSFSLIKKKIRHFYLNSYLYNKKITPSSIELLEYQPSPSLLDGLIKYDKKKINIENYSLNEIWDNPNLKEKDQQNLNSFFWLFSLDLRSSKKDTQNVINQWINTNDRYNSKNWKIDIIGKRIIAWISNSRLTYEDGNIDYKDKFNGTIKKQINHLINEIETSELIDNKIIGCAAIILTGLSYPQNNNYLNTGLSLLKKLAKYSLDNDGFPKSRNIRQLSFYLKYFILIREWFKESQNEIPDFINENIYYLGQAYAFIWQNNKIDFLFNGNHKTNNHNFDLYLKRLGYNFKNQNNELGGYVVLNNKKNSLIMDIGSSPNKKLSSDYQAGALSFEIISNNKKLISNCGYFQKIDHQLNEISKSSAVHSTLILDDKSSCNFNKVRGKKSKINQELRILKKKVVFEKNYWKINASHDGYSKPLGIVHDREIEFYPEQLKFIGHDKIISNKGIKNLKFDIRFHLEPNIRLMKTQDEKSILIDLDGEGWKFSSENSKINIEEGLYFGEKNSFTNNQNIFISGMTNEENQTIRWEITKL GT:EXON 1|1-536:0| BL:SWS:NREP 2 BL:SWS:REP 29->187|YEJM_ECOLI|8e-05|29.2|144/586| BL:SWS:REP 274->405|KI15A_XENLA|2e-04|26.8|127/100| SEG 197->208|lsllkklakysl| BL:PDB:NREP 1 BL:PDB:REP 19->278|2nm1A|7e-04|27.0|237/430| RP:PDB:NREP 1 RP:PDB:REP 59->413|1ddqC|2e-06|8.2|355/1112| RP:PFM:NREP 1 RP:PFM:REP 302->431|PF07940|8e-06|27.7|119/136|Hepar_II_III| HM:PFM:NREP 1 HM:PFM:REP 301->446|PF07940|1.1e-25|31.5|127/139|Hepar_II_III| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111111111111111111111111------1--111-11111111111111111---1-111111111111111111-1------------------------------111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 395 STR:RPRED 73.7 SQ:SECSTR ##################GTTEEEEEEEccccEEccccccEEEEcTTcEEcTTcEEEEccccccccccccccTTGGGGcTHHHHHHccccccTTcccGGGTTHHHHHcccccccTTccccEEccccccEEccccccHTTccccccEEcccccEEccccccccccccccccccccccccccTTcccccccccccccccccccccTTTTcccEEEccccTTccccEEEcccccccccEEcccccccHHHHHHHHccccccccccccccccccTTTcTTTTTcccHHHHHHHHHHHccTTcccccccccTTTTTcccccccGGGcccccTTTGGGGTccccccccccccccccccccHHHHHHHHHTTcccccccccccTTTccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc########################################################################################################################### DISOP:02AL 1-7| PSIPRED cEEccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccHHHHccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccEEcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccHHccEEEEEcccEEEEEEccccccccccccccccccEEEEEEccEEEEEcccccccccHHHHHHHcccccccEEEEEcccccccccccHHHHHcccccEEccccccccccEEEEEEEEccccccccEEEEEEEEEEccccEEEEEEEEEcccccccccEEEEEEcccEEEEEEccccEEEEEEccccEEEEEcccccEEEEccccccccccccccEEEEEEEEccccccEEEEEEEEc //