[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21148.1
DDBJ      :             Outer membrane lipoprotein carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.125.1
:184 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  23->179 1iwlA  b.125.1.1 * 4e-07 14.8 %
:HMM:SCOP  20->179 1iwlA_ b.125.1.1 * 3.2e-13 22.6 %
:HMM:PFM   34->180 PF03548 * LolA 3e-16 27.4 146/165  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21148.1 GT:GENE AAZ21148.1 GT:PRODUCT Outer membrane lipoprotein carrier protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 323636..324190 GB:FROM 323636 GB:TO 324190 GB:DIRECTION + GB:PRODUCT Outer membrane lipoprotein carrier protein GB:PROTEIN_ID AAZ21148.1 GB:DB_XREF GI:71062145 LENGTH 184 SQ:AASEQ MLKVIIILLFFSFYLPGNSSPKDKIISQMKLTNNLNFNFKQTINDKSEDGKCIIEYPKKIFCVYNNANKKILVSNGSSLVIETNNKGSYYRYPLNKTPLEFLLDKEYLISKIEKLEPRDIDNKYLNFKIFENNNEINIFFDKKDLNLIGWQTKDIYQNLSITFISSIKKNQEIDGNIFKLPENN GT:EXON 1|1-184:0| SEG 126->143|nfkifennneiniffdkk| HM:PFM:NREP 1 HM:PFM:REP 34->180|PF03548|3e-16|27.4|146/165|LolA| RP:SCP:NREP 1 RP:SCP:REP 23->179|1iwlA|4e-07|14.8|155/177|b.125.1.1| HM:SCP:REP 20->179|1iwlA_|3.2e-13|22.6|155/182|b.125.1.1|1/1|Prokaryotic lipoproteins and lipoprotein localization factors| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 43-47, 182-184| PSIPRED cHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEEccccEEEEEEccccEEEEEcccEEEEEEcccccEEEEEcccccHHHHccccccccccEEEEccccccEEEEEEEEccccEEEEEEcccccEEEEEEEEcccccEEEEEEEEEEEccccccccEEccccc //