[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21150.1
DDBJ      :             Histidine triad (HIT) protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  713/915 : Eukaryota  133/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->116 1kpfA PDBj 2e-19 44.3 %
:RPS:SCOP  6->115 1av5A  d.13.1.1 * 4e-20 42.9 %
:HMM:SCOP  1->120 1emsA1 d.13.1.1 * 2e-26 38.3 %
:RPS:PFM   17->115 PF01230 * HIT 9e-13 40.4 %
:HMM:PFM   14->115 PF01230 * HIT 2.4e-23 35.1 97/98  
:BLT:SWISS 2->120 YHIT_AZOBR 6e-33 52.6 %
:PROS 94->112|PS00892|HIT_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21150.1 GT:GENE AAZ21150.1 GT:PRODUCT Histidine triad (HIT) protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(324691..325056) GB:FROM 324691 GB:TO 325056 GB:DIRECTION - GB:PRODUCT Histidine triad (HIT) protein GB:PROTEIN_ID AAZ21150.1 GB:DB_XREF GI:71062147 LENGTH 121 SQ:AASEQ MSYDKNNIFAKILRKEIPCKKIFENEYVLSFHDISPQKKIHALVIPKGEYIDLDDFNARASDQEIIALSKAISEVSKILNISTDTGKGYRALTNLSEDGGQEVPHLHFHLFGGEKVGKMVV GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 2->120|YHIT_AZOBR|6e-33|52.6|116/122| PROS 94->112|PS00892|HIT_1|PDOC00694| BL:PDB:NREP 1 BL:PDB:REP 6->116|1kpfA|2e-19|44.3|106/111| RP:PFM:NREP 1 RP:PFM:REP 17->115|PF01230|9e-13|40.4|94/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 14->115|PF01230|2.4e-23|35.1|97/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 6->115|1av5A|4e-20|42.9|105/113|d.13.1.1| HM:SCP:REP 1->120|1emsA1|2e-26|38.3|115/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 969 OP:NHOMOORG 860 OP:PATTERN ---------------1--------1----------11111111-------1-1------------1-1 11--------------------------------------------11-111------11----12-----11111111112-11111111-----------1--------------11-11111111111-1111--------1111111111111111--11111111111111111111111-11--11-111111111111111111111111111---11------21111111111111111111-1---1--1-1-1--11-----11-1111111---1--11111111111-------------111111111-11111111111111111111111-11111---111111111111111111111211111111111111111121211111111111-11-11111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111222222222222222222212222222211-1111111111-11-11111-111111111111111--1111---11111-111111111111111111111111111111111111111111--11111-1111111111111111111111111-111111--11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-11111111111-111111111111111111111111111111-222211111111111111111111111111111111111111111111---111111111111111111-111---111-1---1--1----111------11-11-----111 --11211-311----1111-----------1----111111111-1----1111111--1-1-11111-11--11-1-------1-11-1--1111-----1--1--131421222-1-32-1134-21273-2251112312322112-2--31121111212221223111221111411--111231232211-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 92.6 SQ:SECSTR ####cccHHHHHHTTcccccEEEEcccEEEEEcccccccEEEEEEEcccccccccGGGccGGGHHHHHHHHHHHHHHHHHHHTTcTTcEEEEcccHHHHTcccccccEEEEEcccc##### DISOP:02AL 120-122| PSIPRED ccccccccEEEEEccccccEEEEEcccEEEEEEccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEEEEcccccccccc //