[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21178.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   58->153 PF04390 * RplB 3.2e-05 20.8 96/147  
:HMM:PFM   9->60 PF08829 * AlphaC_N 0.0003 23.1 52/194  
:BLT:SWISS 25->140 ACCD_BARVE 2e-04 33.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21178.1 GT:GENE AAZ21178.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(348228..348692) GB:FROM 348228 GB:TO 348692 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21178.1 GB:DB_XREF GI:71062175 LENGTH 154 SQ:AASEQ MLRKQIILLLLLLLSSCGYEAIYSKKNSVNYSFSVSDLSFVGDRIVNLKIKEKLNNYAQAKKDKDFILRISSTSEKITLAKNTAGDSTSFKNLVSINVEVLMNNKFKSNFIILESFNYNSISNKFNLKKYEDEIKNNLAETAADKLIFKLSNIQ GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 25->140|ACCD_BARVE|2e-04|33.7|101/487| TM:NTM 1 TM:REGION 5->24| SEG 8->14|lllllll| HM:PFM:NREP 2 HM:PFM:REP 58->153|PF04390|3.2e-05|20.8|96/147|RplB| HM:PFM:REP 9->60|PF08829|0.0003|23.1|52/194|AlphaC_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHcccHHHHccccccEEEEEccHHHHHcHHEEEEEHHHHHHHHHHcccccEEEEEEEccccEEEEEEcccccccccHHEEEEEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccc //