[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21180.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   69->163 PF12100 * DUF3576 3e-14 42.6 %
:HMM:PFM   68->170 PF12100 * DUF3576 1.3e-33 40.8 98/104  
:BLT:SWISS 74->163 Y420_RICPR 2e-13 41.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21180.1 GT:GENE AAZ21180.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(351261..351818) GB:FROM 351261 GB:TO 351818 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ21180.1 GB:DB_XREF GI:71062177 LENGTH 185 SQ:AASEQ MNIAKNLKFLFLIFLSAIFLNSCGGKLPGADARKYPPNPEARVKKNIEEGRGFRLSDVGKNKGGTFEFASSNELWRASLDTIDFMPLASVNYSGGIIITDWYSSNVDNESIKISIRFLTNEVRSDALDIKVFNRECNVQFNCVITEKSGNLVSELTNKILKTAAVYEKQMKDKNFKPYITSDPKD GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 74->163|Y420_RICPR|2e-13|41.6|89/100| SEG 7->20|lkflfliflsaifl| RP:PFM:NREP 1 RP:PFM:REP 69->163|PF12100|3e-14|42.6|94/104|DUF3576| HM:PFM:NREP 1 HM:PFM:REP 68->170|PF12100|1.3e-33|40.8|98/104|DUF3576| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------------------------------1---------------111----------11111111-111-111------------1111111111111----1-1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 51-62, 181-185| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccEEHHHHHHHHHHHHHHHHHccccEEEcccccEEEEcccccccccEEEEEEEEEEccccccccEEEEEEEEEccccccEEEccccHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccc //