[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21184.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  94/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->161 PF03734 * YkuD 7.4e-11 30.2 86/116  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21184.1 GT:GENE AAZ21184.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(354238..354726) GB:FROM 354238 GB:TO 354726 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21184.1 GB:DB_XREF GI:71062181 LENGTH 162 SQ:AASEQ MIIHVPNKNTLIIDEFKLKCSVGKSGLNSNKKEGDHSTPKGLFNLRKLYFRKDRVGIPKCKINKKIIEQDMAWCDDPKHKKYNEEITTNNKNFRENLHRKDHKYDYIISISHNEKKTPGKGSAVFIHLTDDYKPTAGCVTLKKKDFEILLKLIDKKTKIKIG GT:EXON 1|1-162:0| SEG 148->161|illklidkktkiki| HM:PFM:NREP 1 HM:PFM:REP 17->161|PF03734|7.4e-11|30.2|86/116|YkuD| OP:NHOMO 94 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1--111111111111111111111111-11111111111-1111111111111111111111111111111111111111-11-----------------------------1--1-1-------------------------------------------------------------------------------------111-----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 162-163| PSIPRED cEEEEccccEEEEcccEEEEEEEcccccccHHcccccccEEEEEccHHcccccccccccccccEEEEcccccEEccccccccccEEEcccccccccEEccHHHccEEEEEccccccccccccEEEEEEccccccccEEEEccHHHHHHHHHHcccccEEEEc //