[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21192.1
DDBJ      :             HAM1-like protein
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  829/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->196 1vp2A PDBj 2e-29 42.7 %
:RPS:PDB   1->200 2carB PDBj 4e-32 24.7 %
:RPS:SCOP  8->200 1k7kA  c.51.4.1 * 1e-45 34.4 %
:HMM:SCOP  6->202 1k7kA_ c.51.4.1 * 2.1e-51 41.5 %
:RPS:PFM   9->196 PF01725 * Ham1p_like 5e-32 41.7 %
:HMM:PFM   9->199 PF01725 * Ham1p_like 9.7e-59 42.7 185/189  
:BLT:SWISS 9->197 NTPA_DICT6 9e-37 45.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21192.1 GT:GENE AAZ21192.1 GT:PRODUCT HAM1-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 361572..362174 GB:FROM 361572 GB:TO 362174 GB:DIRECTION + GB:PRODUCT HAM1-like protein GB:PROTEIN_ID AAZ21192.1 GB:DB_XREF GI:71062189 LENGTH 200 SQ:AASEQ MLKNKIIKLLVGTNNKGKLREIKDLLPKNVEIYSPQDFKIKSPPENGKTFKENSLIKAKFFSKKSKMICLSDDSGLEIDVLDGDPGIYSARWGGKKGDFKKAMNRVFKELDKKDKNWREKKIKARFICALTIYNKNKEIINSIGKVEGFISPVIKGKNGFGYDPIFIPLGKKITFGEMRASQKYKIDHRFKAFKKIKKLF GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 9->197|NTPA_DICT6|9e-37|45.4|183/205| BL:PDB:NREP 1 BL:PDB:REP 7->196|1vp2A|2e-29|42.7|178/189| RP:PDB:NREP 1 RP:PDB:REP 1->200|2carB|4e-32|24.7|186/194| RP:PFM:NREP 1 RP:PFM:REP 9->196|PF01725|5e-32|41.7|180/188|Ham1p_like| HM:PFM:NREP 1 HM:PFM:REP 9->199|PF01725|9.7e-59|42.7|185/189|Ham1p_like| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01725|IPR002637| RP:SCP:NREP 1 RP:SCP:REP 8->200|1k7kA|1e-45|34.4|189/207|c.51.4.1| HM:SCP:REP 6->202|1k7kA_|2.1e-51|41.5|193/209|c.51.4.1|1/1|ITPase-like| OP:NHOMO 921 OP:NHOMOORG 900 OP:PATTERN --11111111111111--11-1-1--------1-----11111------1111111111111111--1 111-111111111111111-111111111111111111111111111111111111111111111111111-11111111-1-1111111111111---111111111111111111111111111111-111111111111111111111111111221122111111112221222121221111111111111111111111111112111111111111111111111111111111111111111111211111111111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-1111111-----------------------------11111111111-111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111-11-111111111111111---------1111111111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111----1---1--------11------1111111111111 1---------1-111----------1---------------11-----1-------------1----------1----------------2-----1-1-11--------1--1-------------1---------------------------------1--------1-----1--------1112-11-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 100.0 SQ:SECSTR cHHHTTcEEEEEcccHHHHHHHHHHHcTTcccEEEEEccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEGGGTTcEETTHHHHHHHHHHHHHHHHTTTTccccEcccccGEEEEEEEEEEEEEEcccTTcccEEEEEEEEEcccccccTTcTTGGGEEETTccccTTTccHHHHHHHcHHHHHHHHHHHHH DISOP:02AL 1-5| PSIPRED ccccccEEEEEEEccHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEccccccccEEHHHccccccHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEEEccccccccccccEEEEEccccccHHcccHHHHHcccHHHHHHHHHHHHc //