[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21195.1
DDBJ      :             Putative phospholipid-binding domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   67->113 PF04972 * BON 1.1e-13 34.0 47/64  
:HMM:PFM   127->186 PF04972 * BON 1.5e-07 16.7 60/64  
:BLT:SWISS 67->188 YGS2_ANACE 8e-17 29.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21195.1 GT:GENE AAZ21195.1 GT:PRODUCT Putative phospholipid-binding domain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 364195..364788 GB:FROM 364195 GB:TO 364788 GB:DIRECTION + GB:PRODUCT Putative phospholipid-binding domain GB:NOTE possible periplasmic protein GB:PROTEIN_ID AAZ21195.1 GB:DB_XREF GI:71062192 LENGTH 197 SQ:AASEQ MKNKIFLISLIFLILTGCVGISSKGVFGTGVSVAFDPRSLGTQIDDSVMQKNLAARLALRDKSYILAVSTKVLDGKIFVTGKVDDPEEKLQITKLAWETKGVRSVKNDIKIKEDFNFKQSAKDLLITSQLRTALIFNKKIKATNYQIDTYKKKIFIYGISLTTEERKEVINEAKEILDVEDVIASIVLVEDLRIQKN GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 67->188|YGS2_ANACE|8e-17|29.5|122/151| TM:NTM 1 TM:REGION 4->26| SEG 5->15|iflisliflil| HM:PFM:NREP 2 HM:PFM:REP 67->113|PF04972|1.1e-13|34.0|47/64|BON| HM:PFM:REP 127->186|PF04972|1.5e-07|16.7|60/64|BON| OP:NHOMO 152 OP:NHOMOORG 151 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111-----------------------111111111111---111111111111111111-------------------------------------1-------1111--111--1--------------------1---------------------------------1-----------------------11-----1-2---------------------------------11111111111111111-11111111111111111111111111-1111111111111111111111111111111111111111----------------111111111111111---------------------------------------111---------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 193-197| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcccccccEEcHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEEcccHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEEEccHHHHHHHHHHHHccccHHEEEcEEEEEcccccccc //