[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21199.1
DDBJ      :             NifU-like domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  264/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
d.267.1d.52.8
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->73 1pqxA PDBj 2e-07 29.6 %
:BLT:PDB   112->177 1vehA PDBj 2e-19 54.5 %
:RPS:SCOP  3->74 2ffmA1  d.267.1.1 * 9e-17 29.2 %
:RPS:SCOP  107->180 1th5A1  d.52.8.1 * 5e-18 28.6 %
:HMM:SCOP  1->90 1pqxA_ d.267.1.1 * 2.5e-25 38.9 %
:HMM:SCOP  95->180 1vehA_ d.52.8.1 * 9.5e-24 45.3 %
:RPS:PFM   3->81 PF08712 * Nfu_N 3e-18 46.8 %
:RPS:PFM   112->177 PF01106 * NifU 4e-18 60.6 %
:HMM:PFM   3->88 PF08712 * Nfu_N 1.2e-29 48.8 86/87  
:HMM:PFM   114->179 PF01106 * NifU 1e-25 46.2 65/68  
:BLT:SWISS 1->177 NIFU4_ARATH 2e-40 45.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21199.1 GT:GENE AAZ21199.1 GT:PRODUCT NifU-like domain protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 369707..370249 GB:FROM 369707 GB:TO 370249 GB:DIRECTION + GB:PRODUCT NifU-like domain protein GB:PROTEIN_ID AAZ21199.1 GB:DB_XREF GI:71062196 LENGTH 180 SQ:AASEQ MFIQTEVTPNPNSLKFLPGKTVSNNGSFEVIKKEETDNELVRNILSINGVTGVFLGEDFISINKNEEVNWEDIKHIAISLINDFYSTGKEFVIANELLGEKKEEHTEIEKQIISILESKIRPAVAKDGGDIKFKEFKDGIVKVELQGSCSGCPSSTMTLKQGVQNLLCHYLPEVKEVVAI GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 1->177|NIFU4_ARATH|2e-40|45.2|177/283| BL:PDB:NREP 2 BL:PDB:REP 3->73|1pqxA|2e-07|29.6|71/91| BL:PDB:REP 112->177|1vehA|2e-19|54.5|66/92| RP:PFM:NREP 2 RP:PFM:REP 3->81|PF08712|3e-18|46.8|79/87|Nfu_N| RP:PFM:REP 112->177|PF01106|4e-18|60.6|66/69|NifU| HM:PFM:NREP 2 HM:PFM:REP 3->88|PF08712|1.2e-29|48.8|86/87|Nfu_N| HM:PFM:REP 114->179|PF01106|1e-25|46.2|65/68|NifU| GO:PFM:NREP 4 GO:PFM GO:0005506|"GO:iron ion binding"|PF08712|IPR014824| GO:PFM GO:0005506|"GO:iron ion binding"|PF01106|IPR001075| GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF01106|IPR001075| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01106|IPR001075| RP:SCP:NREP 2 RP:SCP:REP 3->74|2ffmA1|9e-17|29.2|72/83|d.267.1.1| RP:SCP:REP 107->180|1th5A1|5e-18|28.6|70/73|d.52.8.1| HM:SCP:REP 1->90|1pqxA_|2.5e-25|38.9|90/91|d.267.1.1|1/1|Hypothetical protein SAV1430| HM:SCP:REP 95->180|1vehA_|9.5e-24|45.3|86/0|d.52.8.1|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 578 OP:NHOMOORG 448 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------11---1111-----------221122122-1-------------------------------11---1221221111111111111111111111111111111-------1-111111111111111111-111111111111-11111111--1111111111111111111--------------------------------------------------------------------------1-----------------------1------21--------------1-111211111111111121111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----------------------------------------------1------------------1-1---2----2---1111--1-1111111----1-11------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-------------------------------------- 1---111-523-1111111111111-111111111111111111111111111111111111122111121122211-1112222211-11111111111111112-1212363232111111131111984-1111-111111-1111-11111111121-21111311-11112211Q2331124651442221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 96.7 SQ:SECSTR ##ccccccccccEEEEEccccccccccEEEccccccccHHHHHHHHcTTEEEEEEETTEEEEEEcTTcccTTTccccHHHHcccccHHHH####HHHHHccHHccccHHHHHHHHHHHTTHHHHHHHcccccEEEEETTEEEEcccccccccHHHHHHTHHHHHHHHHHHccccccEEEc DISOP:02AL 92-108| PSIPRED cEEEEcccccHHHEEEEcccccccccccccccccccccHHHHHHHccccccEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEc //