[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21206.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y385_PELUB   RecName: Full=Putative metalloprotease SAR11_0385;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:153 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   61->128 1oz9A PDBj 2e-11 42.4 %
:RPS:SCOP  1->137 1xm5A  d.92.1.15 * 2e-15 25.6 %
:HMM:SCOP  7->150 1oz9A_ d.92.1.15 * 6.5e-30 29.2 %
:RPS:PFM   60->144 PF02130 * UPF0054 2e-11 40.2 %
:HMM:PFM   13->146 PF02130 * UPF0054 1.5e-36 33.3 132/145  
:BLT:SWISS 1->153 Y385_PELUB 1e-73 100.0 %
:PROS 118->128|PS01306|UPF0054
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21206.1 GT:GENE AAZ21206.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 375518..375979 GB:FROM 375518 GB:TO 375979 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID AAZ21206.1 GB:DB_XREF GI:71062203 LENGTH 153 SQ:AASEQ MIKIDVVSECTLWSKKIKRNKTFFNSILKFFPKKYKFIGKKINLTILLSNNKNIKKLNKDFRNKNKPTDVLSFPFEKKFNPKKSNYLGDIVISYEFMNKPKNISILEFKQKVVKIFIHGFLHLLGHDHIKLKDFKKMIKEEDLIYKFIKTKVA GT:EXON 1|1-153:0| SW:ID Y385_PELUB SW:DE RecName: Full=Putative metalloprotease SAR11_0385; EC=3.4.24.-; SW:GN OrderedLocusNames=SAR11_0385; SW:KW Complete proteome; Hydrolase; Metal-binding; Metalloprotease;Protease; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->153|Y385_PELUB|1e-73|100.0|153/153| GO:SWS:NREP 4 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| PROS 118->128|PS01306|UPF0054|PDOC01010| SEG 40->59|kkinltillsnnknikklnk| BL:PDB:NREP 1 BL:PDB:REP 61->128|1oz9A|2e-11|42.4|66/141| RP:PFM:NREP 1 RP:PFM:REP 60->144|PF02130|2e-11|40.2|82/142|UPF0054| HM:PFM:NREP 1 HM:PFM:REP 13->146|PF02130|1.5e-36|33.3|132/145|UPF0054| GO:PFM:NREP 2 GO:PFM GO:0008237|"GO:metallopeptidase activity"|PF02130|IPR002036| GO:PFM GO:0008270|"GO:zinc ion binding"|PF02130|IPR002036| RP:SCP:NREP 1 RP:SCP:REP 1->137|1xm5A|2e-15|25.6|129/152|d.92.1.15| HM:SCP:REP 7->150|1oz9A_|6.5e-30|29.2|137/141|d.92.1.15|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------11-1------------------------------------------------------------1--------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1--------------11---------------------------------------------1---------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-------1------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 52.9 SQ:SECSTR ############################################################HHcccccccEEEEEcccEETTEEccEEEEEEEEHHHHHHHHHHHTccHHHHHHHHHHHHHHHHTTccccTTcccHHHHHHH############ PSIPRED cEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcHHHHHHHHHHHcccccccEEEEccccccccccccccccEEEEEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccc //