[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21215.1
DDBJ      :             Novel protein with potential Cupin domain
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  3/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->108 1o4tA PDBj 2e-08 36.5 %
:RPS:PDB   22->126 3balA PDBj 3e-14 13.7 %
:RPS:SCOP  10->125 2f4pA1  b.82.1.9 * 2e-16 25.9 %
:HMM:SCOP  20->123 1x82A_ b.82.1.7 * 9.1e-23 35.6 %
:RPS:PFM   29->130 PF06560 * GPI 1e-07 40.0 %
:HMM:PFM   44->112 PF07883 * Cupin_2 2.4e-17 27.5 69/71  
:BLT:SWISS 22->120 OXDD_BACSU 1e-08 29.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21215.1 GT:GENE AAZ21215.1 GT:PRODUCT Novel protein with potential Cupin domain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(386111..386503) GB:FROM 386111 GB:TO 386503 GB:DIRECTION - GB:PRODUCT Novel protein with potential Cupin domain GB:PROTEIN_ID AAZ21215.1 GB:DB_XREF GI:71062212 LENGTH 130 SQ:AASEQ MIFVKNLASVLSQEWSSTEKYPGVRWKFLIDADFDGSSGLSLGFAEIAPGGDLTLHYHSPAEIYVVTNGKGILNKSGKLETIKKGDVVYIAGNAEHALKNNGKETLEFYWIFPTDRFSEVEYFPAKQKSG GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 22->120|OXDD_BACSU|1e-08|29.3|99/392| BL:PDB:NREP 1 BL:PDB:REP 46->108|1o4tA|2e-08|36.5|63/115| RP:PDB:NREP 1 RP:PDB:REP 22->126|3balA|3e-14|13.7|102/149| RP:PFM:NREP 1 RP:PFM:REP 29->130|PF06560|1e-07|40.0|100/160|GPI| HM:PFM:NREP 1 HM:PFM:REP 44->112|PF07883|2.4e-17|27.5|69/71|Cupin_2| GO:PFM:NREP 4 GO:PFM GO:0004347|"GO:glucose-6-phosphate isomerase activity"|PF06560|IPR010551| GO:PFM GO:0005737|"GO:cytoplasm"|PF06560|IPR010551| GO:PFM GO:0006094|"GO:gluconeogenesis"|PF06560|IPR010551| GO:PFM GO:0006096|"GO:glycolysis"|PF06560|IPR010551| RP:SCP:NREP 1 RP:SCP:REP 10->125|2f4pA1|2e-16|25.9|116/134|b.82.1.9| HM:SCP:REP 20->123|1x82A_|9.1e-23|35.6|104/0|b.82.1.7|1/1|RmlC-like cupins| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------1------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1---------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------11----1-------------------------11-1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 96.9 SQ:SECSTR ##TEEcTTTcEEEEEEETTEEcccEEEEEcccEEETTTTEEEEEEEEcTTEEEccEEEcccEEEEEEEcEEEETTcGGGTcEEccEEEEEcTTcEEcccEEcccEEEEEEEEccEEEEcTTccEEEEE## DISOP:02AL 127-130| PSIPRED cEEEEEcHHccccccccccccccEEEEEEEcccccccccEEEEEEEEccccccccccccccEEEEEEEEEEEEEEccEEEEEEcccEEEEccccEEEEEEcccccEEEEEEEEcccccccEEccHHHccc //