[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ21222.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  37/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->178 3fjvA PDBj 1e-22 36.5 %
:RPS:PFM   6->195 PF12007 * DUF3501 1e-33 42.6 %
:HMM:PFM   8->196 PF12007 * DUF3501 5.4e-68 46.0 187/192  
:BLT:SWISS 40->136 HEM2_AQUAE 4e-04 25.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21222.1 GT:GENE AAZ21222.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 391509..392102 GB:FROM 391509 GB:TO 392102 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID AAZ21222.1 GB:DB_XREF GI:71062219 LENGTH 197 SQ:AASEQ MSKEKRLIEKEDLLPSDVYAKSRKQIRKDLVEFKKDRRIALGPYATFYFESFETMVAQVQEMLHIEKGGDEQLKDELIAYNPLVPSGKELIATLMFEIDNPISRAKFLGKVGGIEEKVFMKINNEIVKAVPEADVDRTSAEGKASSVQFIHFKLNDDQISKFKSDSATIELGIDHKEYTHTTKLSENSIKSLCDDFI GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 40->136|HEM2_AQUAE|4e-04|25.5|94/100| BL:PDB:NREP 1 BL:PDB:REP 8->178|3fjvA|1e-22|36.5|167/190| RP:PFM:NREP 1 RP:PFM:REP 6->195|PF12007|1e-33|42.6|188/192|DUF3501| HM:PFM:NREP 1 HM:PFM:REP 8->196|PF12007|5.4e-68|46.0|187/192|DUF3501| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN ------1-11111111-1-------------------------------------------------- -----------------------------------------111----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1----------111111-111111-11111-11-----------11-----11-----1--------------1---------------------------1111-1-----------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 84.8 SQ:SECSTR #######ccGGGcccHHHHHHHHHHHHHHHHHHHTTTEEEETTTEEEEEccHHHHHHHHHH#HHHHTcccHHHHHHHHHHGGGcccccEEEEEEEEccccHHHHHHHHHHTTTGGGcEEEEETTccEEcEEcTTccHHHHH#ccccEEEEEEE##ccHHHHHHHTTccEEEEEccTTc################### DISOP:02AL 1-5| PSIPRED cccccccccHHHHccHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEEEEEEEEcccHHHHHHHHHHHccccEEEEEEEccEEEEEEEccccccccccccEEEEEEEEEEccHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHcc //